DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and arrdc3b

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001004605.1 Gene:arrdc3b / 447866 ZFINID:ZDB-GENE-040912-182 Length:412 Species:Danio rerio


Alignment Length:417 Identity:104/417 - (24%)
Similarity:169/417 - (40%) Gaps:72/417 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DSNPLGLYQAGQLISGTAELITERPKTIRSIFITINGYGETRWQESEERVGEDGKTTKSLVTHTT 74
            ||| :.::.:|..:||...:.......:||:.|...|..:.||.||...    |..| :...|.|
Zfish    18 DSN-VPVFASGDFVSGRVIVEVTGEIRVRSLNIHAKGLAKVRWTESRSA----GSNT-AYTRHFT 76

  Fly    75 TEVYYSTDQPVY-------GQAGGSQLELPTGKYVFPFRATIP--PNAPTSFNGAHGQIKHEVTL 130
            .||.|...:.|.       .....:...|.:|::.|||...:|  |.| |||.|.||.:::.|..
Zfish    77 EEVEYLNHRDVLILHDRDDDCCDEAFTVLHSGRHEFPFSLELPQTPLA-TSFEGKHGSVRYWVKA 140

  Fly   131 TIDRAVRYNNTFKQCFTVILPHDLNRRLEYKEPLQRLESKSF--WWGSIFGAHKPMIMDVSTSYS 193
            .:.|........|:.|||....|:|..| ...|....:.|:.  |    |....|:.:.......
Zfish   141 ELHRQWLLPMKTKKEFTVFEHIDINTPL-LLSPQAGTKDKTLCCW----FCTSGPVSLSAKIERK 200

  Fly   194 AYVPGQKIHFHLVLDNQSDVQCMDVKVRLIKNVSYRANSSGAKEQLKVTESRVADKHCGEVLKHN 258
            .|.||:.|.....::|.|.      :|.:.|...|:..:..||.::|..:..:|:.. |:.|...
Zfish   201 GYTPGETIQIFAEIENCSS------RVVVPKAALYQTQTFFAKGKVKEIKQLIANLR-GDPLHSG 258

  Fly   259 KAK-FD-EFLTVPPTTPSTQSEKDPIRVSYTLRFIAKTFKLHGGGDLVMDFPITIGTVPL--LGS 319
            |.: :| :.|.:||.:||. .:...|.|.|:|....   .:....:|.::.|:.|||:||  .||
Zfish   259 KTETWDGKMLKIPPISPSI-LDCSIIHVEYSLMVYV---DIPRAVNLTLNLPLVIGTIPLHSFGS 319

  Fly   320 ADDKGPGAEKSQPSGA-------SHP-GSPNFQEDVSDEQFESNTFKPRY------PVY----PF 366
            .    ..:..||.|.|       ..| ..|::.|.::||:.:.::..|..      |:|    .|
Zfish   320 R----TSSVSSQCSMAMSWLGLPERPEAPPSYSEIITDEERQCSSDLPAVRDEIEGPLYAYIHEF 380

  Fly   367 DGKPGTNGSNGAANFPSLYPKAEEAHP 393
            ..:|           |.||.:. :.||
Zfish   381 RFQP-----------PPLYSEV-DPHP 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 43/153 (28%)
Arrestin_C 182..313 CDD:280848 30/132 (23%)
arrdc3bNP_001004605.1 Arrestin_N 22..165 CDD:278754 40/148 (27%)
Arrestin_C 188..311 CDD:280848 30/133 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7396
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.