DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and CG3014

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001138022.2 Gene:CG3014 / 40922 FlyBaseID:FBgn0037519 Length:488 Species:Drosophila melanogaster


Alignment Length:422 Identity:97/422 - (22%)
Similarity:175/422 - (41%) Gaps:86/422 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NPLGLYQAGQLISGTAELITERPKTIRSIFITINGYGETRWQESEERVGEDGKTTKSLVT----- 71
            ||  :|.:|:.|||...|.|::.|.:.::::|:.|..:.:|..|       ||:..:..:     
  Fly    13 NP--VYNSGEYISGRILLRTDKVKRVNAVYVTLEGEAKVQWSMS-------GKSETANYSGHQQY 68

  Fly    72 -HTTTEVYYSTDQPVYGQAGGSQLELPTGKYVFPFRATIPPNAPTSFNGAHGQIKHEVTLTIDRA 135
             |:.|.|:.:|             ....|.:|:.....|||:.|::..|.:|.|.:.::||||:.
  Fly    69 LHSRTNVFDNT-------------LFRAGVHVYVLTLRIPPDCPSTCKGPYGYIAYTISLTIDKP 120

  Fly   136 VRYNNTFKQCFTVILPHDLNRRLEYKEPLQRLESKSF-WWGSIFGAHKPMIMDVSTSYSAYVPGQ 199
            ..::..|::...|:...|||...|:..|::....|.. .|..|.|   |:...::...|.:.|.|
  Fly   121 WGFDEVFRKPIIVVQTLDLN
YNAEFSLPVKDENLKYLCHWPCISG---PICSTLTLPASGFTPLQ 182

  Fly   200 KIHFHLVLDNQS---DVQCMDVKVRL---------IKNVSYRANSSGAKEQLKVTESRVADKHCG 252
            ::.:.|.:||||   |:..::|.::.         :|...|...         :.:..::|:   
  Fly   183 EVPYRLEVDNQSPHYDIIGVEVSIKQHFVFLSRKPVKRNFYSKT---------LVKELISDR--- 235

  Fly   253 EVLKHNKAKFDEFLTVPPTTP-STQSEKDPIRVSYTLRFIAKTFKLHGGGDLVMDFPITIGTVPL 316
             .|:.:|.:::..:.||..|| ||.:....:.:.|||:...||...|...||  ..||.:||..|
  Fly   236 -TLRLSKRQYESSICVPMDTPRSTLNPNYIVFLHYTLQVKLKTGYFHYDTDL--SVPIIVGTTSL 297

  Fly   317 LGSADD--------KGPGAEKSQPSGASHPGSPNFQED---------------VSDEQFES--NT 356
            ....|.        :.|..|:.:......|..|..:||               :.|::..|  :.
  Fly   298 QHLRDSVHTQQPVRRTPTPERQRLIERVTPRPPTVEEDSAGEADPATDEPHRVIEDDEPPSYDSC 362

  Fly   357 FKPRYPVYPFDGKPGTNGSNGAANFPSLY-PK 387
            ..|.:......|...|.|||.|.....:: ||
  Fly   363 LPPSFSFATLAGSQQTLGSNAAVVLQRIHLPK 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 36/148 (24%)
Arrestin_C 182..313 CDD:280848 32/143 (22%)
CG3014NP_001138022.2 Arrestin_N 5..140 CDD:304627 36/148 (24%)
Arrestin_C 164..294 CDD:280848 33/147 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464051
Domainoid 1 1.000 63 1.000 Domainoid score I10233
eggNOG 1 0.900 - - E1_KOG3780
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110793at6960
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
98.900

Return to query results.
Submit another query.