DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and CG2641

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_649737.1 Gene:CG2641 / 40921 FlyBaseID:FBgn0037518 Length:429 Species:Drosophila melanogaster


Alignment Length:493 Identity:141/493 - (28%)
Similarity:211/493 - (42%) Gaps:105/493 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSKVNFVFDSNPLGLYQAGQLISGTAELITERPKTIRSIFITINGYGETRWQESEERVGEDGKT 65
            |.|..:|..|... .:|.:|:.::|.|.|.|...|::..::|...|..:.||.|...|. ..|||
  Fly     1 MPSSCSFELDRRE-PIYYSGETVNGRAILTTTSEKSVNEVYILFEGEAKVRWDERRTRT-RGGKT 63

  Fly    66 TKSLVTHTTTEVYYSTDQPVYGQAGGSQLELPTGKYVFPFRATIPPNAPTSFNGAHGQIKHEVTL 130
            ..........:.|..|...|:|..     .||.|.:.:.|...:|...|:|....:|:|.:||::
  Fly    64 EHYTEYFRGKQQYLYTRTSVFGSG-----NLPPGTHTYNFCIPLPLECPSSVVAQYGKIFYEVSV 123

  Fly   131 TIDRAVRYNNTFKQCFTVILPHDLNRRLEYKEPLQRLESKSF-WWGSIFGAHKPMIMDVSTSYSA 194
            .|||..|:||.|||..|||..::||...:...||.|.:.|.| .|....|   |::..::..:..
  Fly   124 VIDRQWRFNNVFKQPLTVIQTYNLNMSPQLLMPLVREDIKHFCCWPCSSG---PVLSTLTIPFGG 185

  Fly   195 YVPGQKIHFHLVLDNQS---DVQCMDVKVRLIKNVSYRANSSGAKEQLKVTESRVADKHCGE--V 254
            |.|||||.|.|.:||||   |:..:::|::.|  ..::|.:...|.:.|   ....:|.|.:  |
  Fly   186 YAPGQKIRFTLEIDNQSSGYDLNGIELKLKQI--YKFQAQTPHHKTREK---EHSLNKSCQQERV 245

  Fly   255 LKHNKAKFDEFLTVPPTTPSTQSEKDPIRVSYTLRFIAKTFKLHGGGDLVMDFPITIGTVPLLGS 319
            |:.:|.|.:..|.:|...||:::| ..|.|||.:.....|...|...|  .:.||.|||:||:.|
  Fly   246 LRLSKKKIEGTLAIPAVPPSSRTE-GIISVSYQVILTISTGDCHVDSD--FEVPIVIGTIPLIQS 307

  Fly   320 ADDKGPGAE-----KSQPSGASH--PGS------PNFQE---------DV-SDEQFESNTFKPRY 361
            |::....|:     ...|:||:.  |.|      |.|:|         |: .||...::.|.|||
  Fly   308 AENPASAAQWIPETPDTPAGAAADLPPSYDKCKPPTFEEATNFGERFIDIDQDEHNRTDDFIPRY 372

  Fly   362 PVYPFDGKPGTNGSNGAANFPSLYPKAEEAHPATPVKFTPNPVSPAAQKSPP--YTTNTPVASPP 424
            |:|              .||                      ..|:|...||  :.||.||    
  Fly   373 PMY--------------TNF----------------------AMPSAPPQPPEEFATNQPV---- 397

  Fly   425 GGNFEVLGFSIPPDYKPTPSAPAASS------TGGIGW 456
                .||  |:|.|    |:||....      |...||
  Fly   398 ----PVL--SLPHD----PTAPLVGQNNTDRPTQSYGW 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 45/149 (30%)
Arrestin_C 182..313 CDD:280848 40/135 (30%)
CG2641NP_649737.1 Arrestin_N 5..148 CDD:278754 45/149 (30%)
Arrestin_C 171..301 CDD:280848 41/140 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464053
Domainoid 1 1.000 94 1.000 Domainoid score I7396
eggNOG 1 0.900 - - E1_KOG3780
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110793at6960
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
109.900

Return to query results.
Submit another query.