DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and CG1105

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_649688.1 Gene:CG1105 / 40841 FlyBaseID:FBgn0037465 Length:422 Species:Drosophila melanogaster


Alignment Length:411 Identity:111/411 - (27%)
Similarity:168/411 - (40%) Gaps:64/411 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NPLGLYQAGQLISGTAELITERPKTIRSIFITINGYGETRWQESEERVGEDGKTTKSLVTHTTTE 76
            ||...|.|||.::|..:...:.||.:|.|.|...|...|.|.|.:.....:|||...:......|
  Fly    12 NPWNTYYAGQTVNGQVKFTFDSPKKVRGIIIRFLGEANTEWSEEKSVTTSEGKTENEVTQLKGHE 76

  Fly    77 VYYSTDQPVYGQAGGSQLELPTGKYVFPFRATIPPNAPTSFNGAHGQIKHEVTLTIDRAVRYNNT 141
            .|:.....:.|....|:.|||.|.:.:||...:|||.|:||.|..|.:::.:.:|:||..:::..
  Fly    77 EYFKIQYYLLGGKNSSETELPPGTHTYPFTCALPPNLPSSFEGEFGHVRYTIKVTLDRPWKFDQD 141

  Fly   142 FKQCFTVILPHDLNRRLEYKEPLQRLESKSFWWGSIFGAHK-PMIMDVSTSYSAYVPGQKIHFHL 205
            .|..||||.|.|||.....|||.:....|||   ..|.... |:.:..:...:.:|.||.:....
  Fly   142 MKMAFTVIAPVDLN
LNPRVKEPFKLELEKSF---CCFCCRSGPLAVITNIPQTGFVSGQVLPITC 203

  Fly   206 VLDNQSDVQCMDVKVRLIKNVSYRANSSGAKEQLKVTESRV--ADKHCGEVLKHNKAKFDEFLTV 268
            .:||.|:|....||..|.|.|::..|...::::    ||:|  |:...|.|.......|.:.:.:
  Fly   204 EVDNTSNVNLTAVKFELRKLVTFHTNQPRSEKR----ESKVIIANLSVGPVNGGESRTFTQQMEI 264

  Fly   269 PPTTPSTQSEKDPIRVSYTLRFIAKTFKLHGGGDLVMDFPITIGTVPLLG------------SAD 321
            |...|:.......|.:.|.|....:....|  .:|....|||:||:||.|            :..
  Fly   265 PALPPTNLLNCGIIALDYDLHVECEVSGPH--RNLTGKVPITLGTIPLAGVRPPTQFTDAPSAVQ 327

  Fly   322 DKGPGAEKSQP-SGASHPGS--------------------------PNFQE-----------DVS 348
            .:.|....:|| |.||.||.                          |.|.|           |.|
  Fly   328 SEDPSLAPTQPVSPASPPGGDGVGGALGWNVADSTGGGSLYPNIPPPQFVETQYRAPTIAGRDDS 392

  Fly   349 D--EQFESNTFKPRYPVYPFD 367
            :  :......|.||||.:.|:
  Fly   393 EHTQMIGDGAFAPRYPTFQFN 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 47/142 (33%)
Arrestin_C 182..313 CDD:280848 31/133 (23%)
CG1105NP_649688.1 Arrestin_N 6..155 CDD:278754 47/142 (33%)
Arrestin_C 178..307 CDD:280848 31/134 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464056
Domainoid 1 1.000 94 1.000 Domainoid score I7396
eggNOG 1 0.900 - - E1_KOG3780
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110793at6960
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
109.900

Return to query results.
Submit another query.