DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and Vdup1

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001163303.1 Gene:Vdup1 / 38023 FlyBaseID:FBgn0035103 Length:342 Species:Drosophila melanogaster


Alignment Length:332 Identity:85/332 - (25%)
Similarity:131/332 - (39%) Gaps:48/332 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KVNFVFDSNPLGLYQAGQLISGTA--ELITERPKTIRSIFITINGYGETRWQESEERVGEDGKTT 66
            |...:||:..| ||..||.:||..  ||..|.|..  .:...:.|.|..|....:||..:     
  Fly     7 KFLIIFDNTSL-LYFPGQFLSGRVLIELQDETPAL--GLHFHVVGEGVVRNGRRQERTYD----- 63

  Fly    67 KSLVTHTTTEVYYSTDQPVYGQA--GGSQLELPTGKYVFPFRATIPPNAPTSFNGAHGQIKHEVT 129
                    .|.|......:.|..  ||..: |..|.:.|||:..:|...|::|.|.:|.|:    
  Fly    64 --------KENYIDFRMRLLGDVDQGGPAI-LSPGIHSFPFKLGLPLGLPSTFLGRYGWIQ---- 115

  Fly   130 LTIDRAVRYNNTF----KQCFTVILPHDLNRRLEYKEPLQ------RLESKSFWWGSIFGAHKPM 184
            .....|:|.||..    .|.|.|:.|.|||    .::|:.      .:|.|   .|.:......:
  Fly   116 FYCKAALRENNGIIHKNHQVFIVMNPIDLN----LEKPILAQPFTCEVEHK---LGVVCVGGGQI 173

  Fly   185 IMDVSTSYSAYVPGQKIHFHLVLDNQSDVQCMDVKVRLIKNVSYRANSSGAKEQLKVTESRVADK 249
            ...||.....||||:.|.....:.|.|:|.....|..|.:.:.|.|.  |...|.:..|..|..:
  Fly   174 KCRVSLDRGGYVPGENILVTAFISNYSNVSIKRTKASLTETIEYLAR--GKVVQTEKRELAVLVR 236

  Fly   250 HCGEVLKHNKAKFDEFLTVPPTTPSTQSEKDPIRVSYTLRFIAKTFKLHGGGDLVMDFPITIGTV 314
              |::....|.::...|.|||..|:.......|::||.:.|:.:...:.  .::.:..||.:.|.
  Fly   237 --GKIRPGAKDEWHNELYVPPLPPTNLHGCHLIKISYDVFFVIEPKSME--KEIKLQLPIVLATY 297

  Fly   315 PLLGSAD 321
            |...|.|
  Fly   298 PFRHSGD 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 43/157 (27%)
Arrestin_C 182..313 CDD:280848 31/130 (24%)
Vdup1NP_001163303.1 Arrestin_N 8..145 CDD:304627 43/157 (27%)
Arrestin_C 171..299 CDD:214976 32/133 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D137165at6656
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24518
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.