DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and txnipa

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_956381.1 Gene:txnipa / 368359 ZFINID:ZDB-GENE-030804-10 Length:400 Species:Danio rerio


Alignment Length:446 Identity:90/446 - (20%)
Similarity:156/446 - (34%) Gaps:117/446 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSKV---NFVFDSNPLGLYQAGQLISGTAELITERPKTIRSIFITINGYG--ETRWQESEERVG 60
            |:.:|   ...|:......|.:|..::|  :::.|..:..|.:.:.:.|.|  :..:.:.::|..
Zfish     4 MTKRVKVFEIAFNDPSKTFYCSGDKVAG--KVLVEVSEVTRVMAMKVLGVGCAKVEYAKGKQRCR 66

  Fly    61 EDGKTTK-----SLVTHTTTEVYYSTDQPVYGQAGGSQLELPTGKYVFPFRATIPPNAP--TSFN 118
            |:....|     .|..|.|..             .||.:..|..||.:.|...:|....  :|:.
Zfish    67 EEVDYLKYEDVVQLDEHPTDN-------------DGSVILRPGNKYEYSFGFELPAQGQLVSSYK 118

  Fly   119 GAHGQIKHEVTLTIDRAVRYNNTFKQCFTVILPHDLNRRLEYKEPLQRLESKSFWWGSIFGAHKP 183
            |..|.:::.|...::|..:.....|:.|.|..|.|:|.. :...|...::.|           |.
Zfish   119 GKFGFVQYYVKALMERPCQPALECKKHFEVEEPLDVNTP-DLLSPTGGMKEK-----------KV 171

  Fly   184 MIMDVSTSYSAYVPGQKIHFHLVLDN----QSDVQCMDV------------KVRLIKNVSYRANS 232
            ..|        ::|..::..:..:|.    :.:..|:|.            |..::...:|:||.
Zfish   172 TCM--------FIPDGQVSLNAKIDRRGFCEGEEICIDAKFENTCSRIVVPKAAIVAKQTYQANG 228

  Fly   233 SGAKEQLKVTESR-------VADKHCGEVLKHNKAKFDEFLTVPPTTPSTQSEKDPIRVSYTLRF 290
            .....:.|::..|       :.|...|:.::           ||...||... .:.|||.|.|..
Zfish   229 RTKVFRQKLSSVRGNHIISGMCDAWQGKSIR-----------VPKIKPSILG-CNIIRVEYALMI 281

  Fly   291 IAKTFKLHGGGDLVMDFPITIGTVPLLG---------SADDKGPGAEKS-----QPSGASHPGSP 341
            .   ..:.|...|:::.|:.|||||..|         |.|.....|..|     .||.|. |...
Zfish   282 Y---MHIPGSEKLILELPLVIGTVPYNGFGSRTNSMSSQDGSISNASNSWVSLRMPSSAP-PSYC 342

  Fly   342 NFQEDVSDEQFESNTFKPRYPVYP----FDGKPGTNGSNGAA-NFPSL--YPKAEE 390
            :...|...:|          |:.|    :||.......|.|. .||.|  |.:.||
Zfish   343 DITRDCCIDQ----------PLTPLLDDYDGGDSPIFMNAAQFQFPPLPAYSEVEE 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 32/161 (20%)
Arrestin_C 182..313 CDD:280848 27/153 (18%)
txnipaNP_956381.1 Arrestin_N 11..155 CDD:304627 31/158 (20%)
Arrestin_C 178..304 CDD:214976 27/140 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.