DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and Arrdc2

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001100773.2 Gene:Arrdc2 / 306344 RGDID:1309659 Length:407 Species:Rattus norvegicus


Alignment Length:439 Identity:96/439 - (21%)
Similarity:155/439 - (35%) Gaps:105/439 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LYQAGQLISGTAELITERPKTIRSIFITINGYGETRWQESEERVGEDGKTTKS------LVTHTT 74
            ::..||.::|...|.......:.::.:...|.....|.||.. .|.....|:|      :|.|..
  Rat    23 VFHGGQAVAGRVLLELAGAARVGALRLRARGRARAHWTESRS-AGSSTAYTQSYSERVEVVNHRA 86

  Fly    75 TEVYYSTDQPVYGQAGGSQLELPTGKYVFPFRATIPPNAPTSFNGAHGQIKHEVTLTIDRAVRYN 139
            |         :.....|..:.||.|::.|||...:|.:..|||.|.||.:::.:..|:.|.....
  Rat    87 T---------LLAPDSGDIVMLPAGRHEFPFSFQLPISLVTSFEGKHGSVRYSIKATLHRPWVPA 142

  Fly   140 NTFKQCFTVILPHDLNRRLEYKEPLQRLESKSFWWGSIFGAHKPMIMDVSTSYSAYVPGQKIHFH 204
            ...::.||||.|.|:|.....:......|..:..|....|.   :.:........|.||:.|...
  Rat   143 RRARKVFTVIEPVDINTPALLEPQAGAREKVARSWYCTRGL---VSLSAKIDRKGYTPGEVIPIF 204

  Fly   205 LVLDNQSDVQCMDVKVRLIKNVSYRANSSGAKEQLKVTESRVADKHCG---EVLKHNKAKFDEFL 266
            ..:||.| .:.:..:..|::..::.|.  ||::|.....:.|..:..|   ..|...:|     |
  Rat   205 AEIDNGS-TRAVQPRAALVQTQTFMAR--GARKQKCAVVASVDGEPVGPGRRALWPGRA-----L 261

  Fly   267 TVPPTTPSTQSEKDPIRVSYTLRFIAKTFKLHGGGDLVMDFPITIGTVPL--LGS---------- 319
            .:||..||....: .:.|.|:|:...   .:.|...|:::.|:.||||||  |||          
  Rat   262 RIPPVGPSILHCR-VLSVDYSLKVCV---DIPGSSKLLLELPLVIGTVPLHPLGSRSASVGSRAS 322

  Fly   320 -ADDKGPGAEKSQPSGASHPGSPNFQEDVSDEQFESNTFKPRYPVYPFDGKPGTNGSNGAANF-- 381
             ..|.|..|...:|.     ..|.:.|.|.:                   .|....|.|..:|  
  Rat   323 FLQDWGLCALMERPE-----APPEYSEVVRE-------------------SPQVAASQGLFSFLH 363

  Fly   382 ---------------------PSLYPKAEEAHPATPVKFTPNPVSPAAQ 409
                                 |.||.:.:           |||.|.||:
  Rat   364 DPDVTTEGPYFACLQEFRYRPPPLYSEED-----------PNPPSEAAR 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 36/144 (25%)
Arrestin_C 182..313 CDD:280848 28/133 (21%)
Arrdc2NP_001100773.2 Arrestin_C 180..307 CDD:214976 32/141 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.