DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and Arrdc4

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001380690.1 Gene:Arrdc4 / 293019 RGDID:1311763 Length:415 Species:Rattus norvegicus


Alignment Length:438 Identity:106/438 - (24%)
Similarity:171/438 - (39%) Gaps:84/438 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VNFVFDSNPLGLYQAGQLISGTAELITERPKTIRSIFITINGYGETRWQESE-ERVGEDGKTTKS 68
            :..||:....|.|.:|:.::|...|....|.|:|.:.:...|...:.|..|. .||...|.:..:
  Rat    17 LGLVFEDESKGCYSSGETVAGHVLLEAAEPVTLRGLRLEAQGRATSAWGPSAGARVCIGGASPAA 81

  Fly    69 LVTHTTTEVYYST------DQPVYGQAGGSQLELPTGKYVFPFRATIP--PNAPTSFNGAHGQIK 125
                 ::||.|..      :.|    ||.....|..||:.||||..:|  |.| |||.|.:|.|:
  Rat    82 -----SSEVEYLNLRLSLLEAP----AGEGVTLLQPGKHEFPFRFQLPSEPLA-TSFTGKYGSIQ 136

  Fly   126 HEVTLTIDRAVRYNNTFKQCFTVILPHDLNRRLEYKEPLQRLESKSFWWGSIFGAHKPMIMDVST 190
            :.|...::|....:.:.::...|:...|:|........|:..|.....|....|   |:.:.|..
  Rat   137 YCVRAVLERPQVPDQSVRRELQVVSHVDVNTPPLLTPMLKTQEKMVGCWLFTSG---PVSLSVKI 198

  Fly   191 SYSAYVPGQKIHFHLVLDNQSDVQCMDVKVRLIKNVSYRANSSGAKEQLKVTESRVADKHCGEVL 255
            ....|..|:.|..:..::|.|. :.:..|..:.:..:|.|  ||..:.::...:.|...|.|   
  Rat   199 ERKGYCNGEAIPIYAEIENCSS-RLVVPKAAIFQTQTYLA--SGKTKTVRHMVANVRGNHIG--- 257

  Fly   256 KHNKAKFD----EFLTVPPTTPSTQSEKDPIRVSYTLRFIAKTFKLHGGGDLVMDFPITIGTVPL 316
               ....|    :.|.:||.|||. .:...|||.|:|   |....:.|...|:::.|:.|||:|.
  Rat   258 ---SGSTDTWNGKMLKIPPVTPSI-LDCCIIRVDYSL---AVYIHIPGAKKLMLELPLVIGTIPY 315

  Fly   317 LGSADDKGPGAEK-------------SQPSGASHPGSPNFQEDVSDEQFESNTFKPRYPVYPFDG 368
            .|........|.:             .||.     ..||:.:.||:|:|..:     .|.||   
  Rat   316 SGFGRRNSSMASQFSMDMCWLALALPEQPE-----APPNYADVVSEEEFSRH-----IPPYP--- 367

  Fly   369 KPGTNGSNGAANF-------------PSLY----PKAEEAHPATPVKF 399
            :|  :..:|.|.:             |.||    |...:|....||.|
  Rat   368 QP--SACDGEACYSMFACIQEFRFQPPPLYSEVDPHPGDAQETQPVSF 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 42/158 (27%)
Arrestin_C 182..313 CDD:280848 32/134 (24%)
Arrdc4NP_001380690.1 Arrestin_N 19..166 CDD:395268 42/156 (27%)
Arrestin_C 188..315 CDD:214976 35/142 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.