DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and ZK938.11

DIOPT Version :10

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001317870.1 Gene:ZK938.11 / 28661663 WormBaseID:WBGene00270290 Length:129 Species:Caenorhabditis elegans


Alignment Length:120 Identity:31/120 - (25%)
Similarity:51/120 - (42%) Gaps:21/120 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 EVYYSTDQPVYGQAGGSQLELPTGKYVFPFRATIPPNAPTSFNGAHGQIKHEVTLTIDRAVRYNN 140
            |.|:.....|:....|.. :||.......|...||..:..::...|  ||:.::|.:||..:.|.
 Worm    11 ETYFKRSAIVWTSKDGKN-KLPVELLEKSFEFQIPTGSRLTYKAGH--IKYTMSLEVDRPWKTNL 72

  Fly   141 TFKQCFTVILPHDLNRRLEYKEPLQRLESKSFWWGSIFGAHKPMI----MDVSTS 191
            ..|:  .||:.    |:|:..| :...|:|:.       ::||.|    |..|||
 Worm    73 KVKK--EVIVA----RKLDVDE-VYFTENKTV-------SNKPAIGVFQMGSSTS 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:425619 19/78 (24%)
Arrestin_C 182..316 CDD:460676 7/14 (50%)
PHA03247 <313..450 CDD:223021
ZK938.11NP_001317870.1 Arrestin_N <11..86 CDD:451447 21/83 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.