DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and ARRDC2

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_056498.1 Gene:ARRDC2 / 27106 HGNCID:25225 Length:407 Species:Homo sapiens


Alignment Length:424 Identity:95/424 - (22%)
Similarity:164/424 - (38%) Gaps:85/424 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LYQAGQLISGTAELITERPKTIRSIFITINGYGETRWQESEERVGEDGKTTKS------LVTHTT 74
            ::..||.::|...|.......:.::.:...|.....|.||.. .|.....|:|      :|:|..
Human    23 VFSGGQAVAGRVLLELSSAARVGALRLRARGRAHVHWTESRS-AGSSTAYTQSYSERVEVVSHRA 86

  Fly    75 TEVYYSTDQPVYGQAGGSQLELPTGKYVFPFRATIPPNAPTSFNGAHGQIKHEVTLTIDRAVRYN 139
            |.:...|         |....||.|::.|.|...:||...|||.|.||.:::.:..|:.|.....
Human    87 TLLAPDT---------GETTTLPPGRHEFLFSFQLPPTLVTSFEGKHGSVRYCIKATLHRPWVPA 142

  Fly   140 NTFKQCFTVILPHDLNR------RLEYKEPLQRLESKSFWWGSIFGAHKPMI-MDVSTSYSAYVP 197
            ...::.||||.|.|:|.      :...:|.:.|     .|:     .::.:: :........|.|
Human   143 RRARKVFTVIEPVDIN
TPALLAPQAGAREKVAR-----SWY-----CNRGLVSLSAKIDRKGYTP 197

  Fly   198 GQKIHFHLVLDNQSDVQCMDVKVRLIKNVSYRANSSGAKEQLKVTESRVADKHCG---EVLKHNK 259
            |:.|.....:||.|....:. :..:::..::.|.  ||::|.:...:.:|.:..|   ..|...:
Human   198 GEVIPVFAEIDNGSTRPVLP-RAAVVQTQTFMAR--GARKQKRAVVASLAGEPVGPGQRALWQGR 259

  Fly   260 AKFDEFLTVPPTTPSTQSEKDPIRVSYTLRFIAKTFKLHGGGDLVMDFPITIGTVPL--LGSAD- 321
            |     |.:||..||....: .:.|.|.|:...   .:.|...|:::.|:.|||:||  .||.. 
Human   260 A-----LRIPPVGPSILHCR-VLHVDYALKVCV---DIPGTSKLLLELPLVIGTIPLHPFGSRSS 315

  Fly   322 ----------DKGPGAEKSQPSGASHPGSPNFQEDVSDEQFESNTFKPRYPVYPFDGKPGTNGSN 376
                      |...||...:|.     ..|.:.|.|:|.: |:...:..:|: |.|......|..
Human   316 SVGSHASFLLDWRLGALPERPE-----APPEYSEVVADTE-EAALGQSPFPL-PQDPDMSLEGPF 373

  Fly   377 GA--ANF----PSLYPKAEEAHPATPVKFTPNPV 404
            .|  ..|    |.||.:.:           |||:
Human   374 FAYIQEFRYRPPPLYSEED-----------PNPL 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 37/144 (26%)
Arrestin_C 182..313 CDD:280848 27/134 (20%)
ARRDC2NP_056498.1 Arrestin_N 9..158 CDD:278754 37/144 (26%)
Arrestin_C 181..307 CDD:214976 29/137 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.