DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and SPAC1F12.05

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_594331.1 Gene:SPAC1F12.05 / 2542260 PomBaseID:SPAC1F12.05 Length:377 Species:Schizosaccharomyces pombe


Alignment Length:179 Identity:35/179 - (19%)
Similarity:64/179 - (35%) Gaps:42/179 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 FKQCFTVILPHDLNRRLEYKEPLQRLESKSFWWGSIFGAHKPMIM----DVSTSYSAYVPGQKIH 202
            |:...|...|.:||.::|                     ..|::|    |||:...|....:...
pombe     8 FQHASTEEQPFELNIQME---------------------SPPLVMYGNPDVSSGALASGLAKLTV 51

  Fly   203 FHLVLDNQSDVQCMDVKVRLIKNVS----YRANSSGAKEQLKVTESRVADKHCGEVLKHNKAKFD 263
            |      .:|::|..:.:..::.:|    .|.:....|.|::..|.....|. ..|..|....:.
pombe    52 F------PADLKCESIVMEFVRIISTKRPLRDSCPDCKAQVEAFEKWEFSKE-PTVYTHGTHTWP 109

  Fly   264 EFLTVPPTTPSTQSEKDP-IRVSYTLRFIAKTFKLHGGGDLVMDFPITI 311
            ....:|...|  |:...| |.|:|.|:   ...|:....|.|.::|:.:
pombe   110 FTFIIPGHFP--QTTNSPFINVTYILK---TRVKIPSQPDFVFEYPLNL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 3/12 (25%)
Arrestin_C 182..313 CDD:280848 29/139 (21%)
SPAC1F12.05NP_594331.1 LDB19 63..231 CDD:193475 20/97 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.