DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and SPBC18H10.20c

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_595744.1 Gene:SPBC18H10.20c / 2540833 PomBaseID:SPBC18H10.20c Length:361 Species:Schizosaccharomyces pombe


Alignment Length:236 Identity:52/236 - (22%)
Similarity:75/236 - (31%) Gaps:78/236 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 PSTQSEKDPIRVSYTLRFIAKTFKLHGGGDLVMDFPITIGTVPL--LGSADDKGPGAEKS----- 330
            |.:.:.|||.|.:..:|               |:.|      ||  |||.:... ||..|     
pombe     8 PRSTTPKDPARCTLDIR---------------MESP------PLVFLGSPETSS-GALASGILKL 50

  Fly   331 ----QP-------------------SGASHPGSPNFQEDVSD--EQFESNTFKPRYPVYPFDGK- 369
                ||                   ...||..:....::|..  :...:.|::|....:||... 
pombe    51 TILHQPFIKVHTLKLQLIKRITVLHPAISHCSACAGSKEVLQTWDLAANTTYRPGTQHWPFSWLF 115

  Fly   370 PGTNGSNGAANFPSLYPKAEEAHPATPVKFTP----NPVSPAAQKSPPYTTNTPVASP------- 423
            ||:.    .|:..:.|.|.|....||....||    :|..|...|.|.......:.||       
pombe   116 PGSL----PASVSNRYIKLEYYLEATLCYGTPEGGISPSKPEVLKFPLQLKRAAIPSPDTIHKRI 176

  Fly   424 -PGGNFEVLGFSIPPDYKPTPSA-PAASSTG-----GIGWK 457
             |..|. |...::|....|..:| ...:.||     |..||
pombe   177 FPPTNL-VANITLPSTLHPHGAALMEVTMTGFAQNDGNDWK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754
Arrestin_C 182..313 CDD:280848 8/39 (21%)
SPBC18H10.20cNP_595744.1 LDB19 63..242 CDD:193475 34/159 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.