DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and SPBC2D10.04

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_596223.1 Gene:SPBC2D10.04 / 2540410 PomBaseID:SPBC2D10.04 Length:658 Species:Schizosaccharomyces pombe


Alignment Length:264 Identity:64/264 - (24%)
Similarity:90/264 - (34%) Gaps:94/264 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LYQAG-----------QLISGTAELITERPKTIRSIFITINGYGETRWQESEERVGEDGKTTKSL 69
            ||.||           .|:.|...|...:|..||.|.::..|...|.|.|.....|.|....|.:
pombe   158 LYLAGFDLNECQIENPALLRGALVLRVAKPANIRGISLSFTGRSRTEWPEGIPVKGHDTYEDKVI 222

  Fly    70 VTHTTTEVYYST----DQPVYG----QAGGSQLELPT--------------GKYVFPFRATIPPN 112
            ::| ..:.|..|    |.|.:|    :..|.||.||:              |:|.:.|...||..
pombe   223 ISH-NWKFYEPTMKDADAPQHGADVARLVGEQLPLPSSAAASLRGYSVFAPGEYTYNFDLAIPNC 286

  Fly   113 APTSFNGAHGQIKHEVTLTIDRAVRYNNTFKQCFT---------------------VILPHDLNR 156
            .|.|.....|.:::.:..|::|.    .|||....                     :.:..|.:.
pombe   287 FPESVEAKMGWVRYFLEATVERF----GTFKSNLNGRTPVQLVRTPSPASLSSSELINISRDWDE 347

  Fly   157 RLEYKEPLQRLESKSFWWGSIFGAHKPMIMDVSTSYSAYVPGQKIHFH-LVLDNQSDVQCMDVKV 220
            ||.|:  || :..|||..|.:                  ||   |.|. |:||          ||
pombe   348 RLHYE--LQ-VSGKSFRLGEV------------------VP---ITFRFLLLD----------KV 378

  Fly   221 RLIK 224
            ||.|
pombe   379 RLYK 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 43/192 (22%)
Arrestin_C 182..313 CDD:280848 12/44 (27%)
SPBC2D10.04NP_596223.1 Arrestin_N 178..308 CDD:304627 33/130 (25%)
Arrestin_C 345..506 CDD:214976 21/72 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.