DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and arrd-15

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001254970.1 Gene:arrd-15 / 191372 WormBaseID:WBGene00014033 Length:374 Species:Caenorhabditis elegans


Alignment Length:312 Identity:70/312 - (22%)
Similarity:133/312 - (42%) Gaps:51/312 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSKVNFVFDSNPLGLYQAGQLISGTAELITERPKT-IRSIFITINGYGETRWQE-SEERVGEDGK 64
            ::::|.|. :.|..:  ||:..:....|.:..|.| :.|....|.|.|.|.|.. ..:::.|..|
 Worm    35 TTQINIVL-AEPRCM--AGEFFNAKVLLDSSDPDTVVHSFCAEIKGIGRTGWVNIHTDKIFETEK 96

  Fly    65 TTKSLVTHTTTEVYYSTDQPVYGQAGGSQLELPTGKYVFPFRATIPPNAPTSFNGAHGQIKHEVT 129
                  |:..|:|          |...|...||.||:.||.:..||.|.|:|:....|.|::::.
 Worm    97 ------TYIDTQV----------QLCDSGTCLPVGKHQFPVQIRIPLNCPSSYESQFGSIRYQMK 145

  Fly   130 LTIDRAVRYNNTFKQCFTVILPHDLNRR------LEYKEPLQRLESKSFWWGSI-FGAHKPMIMD 187
            :.: ||.....:..:.|.:::   |.|.      |....|:...:...|...:: ||.   :.::
 Worm   146 VEL-RASTDQASCSEVFPLVI---LTRSFFDDVPLNAMSPIDFKDEVDFTCCTLPFGC---VSLN 203

  Fly   188 VSTSYSAYVPGQKIHFHLVLDNQSDVQCMDVKVRLIKNVSYRANSSGAKEQLKVTESRVADK--- 249
            :|.:.:|:..|:.|...:.::|::.....:|.::||....:.|.|    ....|.|.::|::   
 Worm   204 MSLTRTAFRIGESIEAVVTINNRTRKGLKEVALQLIMKTQFEARS----RYEHVNEKKLAEQLIE 264

  Fly   250 --HCGEVLKHNKAKFDE-FLTVPPTTPSTQS------EKDPIRVSYTLRFIA 292
              ..|.|....:.:|:: .|.:|...|.||:      |...|.:.|.|:..|
 Worm   265 MVPLGAVKSRCRMEFEKCLLRIPDAAPPTQNYNRGAGESSIIAIHYVLKLTA 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 37/151 (25%)
Arrestin_C 182..313 CDD:280848 26/123 (21%)
arrd-15NP_001254970.1 Arrestin_N 49..148 CDD:304627 31/114 (27%)
Arrestin_C 198..330 CDD:280848 27/126 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.