DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and arrd-16

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_499629.2 Gene:arrd-16 / 190071 WormBaseID:WBGene00013043 Length:399 Species:Caenorhabditis elegans


Alignment Length:416 Identity:102/416 - (24%)
Similarity:169/416 - (40%) Gaps:83/416 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SNPLGLYQAGQLISGTAELITERPKTIRSIFITINGYGETRWQESEERVGEDGKTTKSLVTHTTT 75
            ||...:|:.|..|.|...........:::|.|:..|...|:|..||......|::.:  |:::..
 Worm    10 SNCEQIYEPGGTIEGYVTFDLRESVKVKAIRISAEGLATTKWLLSESSKSSHGRSRE--VSYSAK 72

  Fly    76 EVYYSTDQPVYGQA-GGSQLELPTGKYVFPFRATIPPNAPTSFNGAHGQIKHEVTLTIDRAVRYN 139
            ..|...:|.|:..: |.|:..:..|.:|:||:..||...|.||.|.||.|::.:..|::|..:.|
 Worm    73 VTYLDEEQMVWKPSEGHSKSSVFPGIHVYPFKFQIPIGVPPSFEGDHGNIRYHMKATVERPWKTN 137

  Fly   140 NTFKQCFTVILPHDLNRRLEYKEPLQRLESKS-----FWWGSIFGAHKPMIMDVSTSYSAYVPGQ 199
            .:..:..|::.|.|||:.:...|.....:||.     |.:|.:       .:.:......||||:
 Worm   138 RSVTRYLTILPPKDLN
KEVLASEETSSWKSKKVGFFLFRYGKV-------NLQIRIPKKGYVPGE 195

  Fly   200 KIHFHLVLDNQSDVQCMDVKVRLIKN---VSYRANSSG-------------------AKEQLKVT 242
            .|.....:||.|....:..:..||:.   ::||...||                   .::::|:.
 Worm   196 TISIETNIDNMSSRPILKTECYLIQQCRFLAYRYGISGPTDGRRASSLSENDRYLSRKRDEIKIV 260

  Fly   243 ESRVADKHCGEVLKHNKAKFDEFLTVPPTTPSTQSEKDPIRVSYTLRFIAKTFKLH----GGGDL 303
             |.:.:.|.....:| |||..  |.:|.|.|:..|..  |.|.|   |:  ..|||    ....:
 Worm   261 -SVIHEMHIEPRTEH-KAKMR--LKIPCTCPTFDSTL--IHVEY---FV--VVKLHVKCRMRNTV 314

  Fly   304 VMDFPITIGTVPLLGSADDKGPGAEKSQPSGASHPGSPNFQEDVSDEQFESNTFK---------- 358
            ..:.||.||:.||.....|               |.:|.:||..:   |.:.|.:          
 Worm   315 KAECPIIIGSKPLADEHVD---------------PRTPTYQEVAT---FSALTHRSMMSVDEKLT 361

  Fly   359 PRYPVYPFDGKPGTNGSNGAANFPSL 384
            |:|..||   |.|.:..:.|...|||
 Worm   362 PKYVYYP---KYGKSRDDEADEPPSL 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 39/144 (27%)
Arrestin_C 182..313 CDD:280848 36/156 (23%)
arrd-16NP_499629.2 Arrestin_N 9..153 CDD:334019 39/144 (27%)
Arrestin_C 178..327 CDD:214976 38/166 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.