DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and arrd-23

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_508830.3 Gene:arrd-23 / 188239 WormBaseID:WBGene00020323 Length:444 Species:Caenorhabditis elegans


Alignment Length:370 Identity:90/370 - (24%)
Similarity:141/370 - (38%) Gaps:81/370 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YQAGQLISGTAEL-ITERPKTIRSIFITINGYGETRWQESEERVGEDGKTTKSLVTHTTTEVYYS 80
            |..|..|.|...| |:|....|.|:.|..:|||         ::...||..:.|..:.|....:|
 Worm    27 YNWGDTIQGKLNLKISEGSIEITSLRILFHGYG---------KINCKGKKDELLQENMTYMKKFS 82

  Fly    81 T--DQPVYGQAGGSQLELPTGKYVFPFRATIPPNAPTSFNGAHGQIKHEVTLTID---------- 133
            .  .||:.    .||.|     |..|...|:|...|||.....|.|::.:..|::          
 Worm    83 NAISQPIV----VSQQE-----YSIPIEETLPDQLPTSVYSPKGHIQYVIQCTLEYKTAAGTPSI 138

  Fly   134 -RAVRYNNTFKQCFTVILPHDLNR-RLEYKEPLQRLESKSFWWGSIFGAHKPMIMDVSTSYSAYV 196
             :|||       ..|||...|||: ...:.||....|.:.|.|.:..|.|  :.:.::...||:|
 Worm   139 VKAVR-------GITVIESLDLNKISKTWFEPKTEFEQRKFGWFACTGGH--IRLHLTFERSAFV 194

  Fly   197 PGQKIHFHLVLDNQSDVQCMDVKVRLIKNVSYRANSSGAKEQLKVTESRVADKHCGEVLKHNKA- 260
            .|:.|.|...::|:||.:...|.|.|::|..:..:.....|...|....:.:......::.... 
 Worm   195 CGEAIPFIGKIENKSDRRIEKVSVCLMRNTRFGNDVEDDVENATVDHHLIQEDLMAMYIEEGCVN 259

  Fly   261 KFDEFLTVPPTTPST-----------------------------QSEKDPIRVSYT---LRFIAK 293
            |.|:.:.:|.|.|||                             .|:|....:|.|   .|.:|.
 Worm   260 KIDKKVHIPCTAPSTPLPILFRSGQLDGNKFQLRRKSQLGRLSLTSQKSRQSISSTSNMQRILAI 324

  Fly   294 TF----KLHGGGDLVMDF--PITIGTVPLLGSADDKGPGAEKSQP 332
            |:    |:...|..|:|.  |:.|||||.:...:...|.....:|
 Worm   325 TYAFLIKVRSNGMDVIDLSVPVVIGTVPYIDHVNSGDPSDPLDRP 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 40/151 (26%)
Arrestin_C 182..313 CDD:280848 35/169 (21%)
arrd-23NP_508830.3 Arrestin_C 180..353 CDD:214976 39/174 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.