DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and arrd-26

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_500160.2 Gene:arrd-26 / 187599 WormBaseID:WBGene00019873 Length:323 Species:Caenorhabditis elegans


Alignment Length:346 Identity:78/346 - (22%)
Similarity:133/346 - (38%) Gaps:73/346 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YQAGQLISGTAELITERPKTIRSIFITINGYGETRWQESEERVGEDGKTT--KSLVTHTTTEVYY 79
            |..|..|.|..|::..:...|..:.:.:.|..||.|:..::.:..:.:.|  ...:..|||...:
 Worm    18 YLGGDPIKGIIEMVCSKQVRITGLIVRLTGVAETGWRSRQDDLPYESRHTFMDEQIDLTTTIAEH 82

  Fly    80 STDQPVYGQAGGSQLELPTGKYVFPFRATIPPNAPTSF-NGAHGQIKHEVTLTI------DRAVR 137
            .||          :.||..||:...|...||.:..:|. ...||.|::..|..:      |..|.
 Worm    83 CTD----------EFELHEGKHSVEFEGRIPLDVLSSVERDNHGSIRYMCTALMAIPEDGDTEVV 137

  Fly   138 YNNTFKQCFTVI---LPHDLNRRLEYKEPLQRLESKSFWWGSIFGAHKPMIMDVSTSYSAYVPGQ 199
            ...||| .|:::   .|:     |..|..:...|..:...|...||   :|..:.......:||.
 Worm   138 SEKTFK-VFSLLNL
DAPY-----LHDKAHVTEEEEITGCCGRRKGA---LIATMQVDEIGVMPGM 193

  Fly   200 KIHFHLVLDNQS-----------DVQCMDVKVRLIKNVSYRA---NSSGAKEQLKVTESRVADKH 250
            .....|.::|::           :.:|  |.:.|.:.:.:.|   |.....::..:|.:..:...
 Worm   194 TSKISLTVENKTKKRKKWMRKKDNHEC--VLLSLCQQLDFVAVNRNDPMMIDRKSITIAVESHGT 256

  Fly   251 CGEVLKHNKA------KFDEFLTVPPTTPSTQSEKDP-IRVSYTLRFIAKTFKLHGGGDLVMDFP 308
            |     ..||      |..|| :|||..|.|....:. :.|||..:.....|      |||:  |
 Worm   257 C-----KTKAGVGPQTKEIEF-SVPPNLPPTSIHANRLVTVSYFFKLDLDHF------DLVL--P 307

  Fly   309 ITIGTVPLLGSADDKGPGAEK 329
            :.:|:|.  .||.:   |:||
 Worm   308 VIVGSVK--SSASN---GSEK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 35/149 (23%)
Arrestin_C 182..313 CDD:280848 30/151 (20%)
arrd-26NP_500160.2 Arrestin_N 6..150 CDD:389964 34/142 (24%)
Arrestin_C 174..314 CDD:367164 33/158 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.