DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and arrd-24

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_510328.2 Gene:arrd-24 / 185991 WormBaseID:WBGene00009852 Length:346 Species:Caenorhabditis elegans


Alignment Length:365 Identity:99/365 - (27%)
Similarity:157/365 - (43%) Gaps:67/365 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VFDSNPLGLYQAGQLISGTAELITERPKTIRSIFITINGYGETRWQESEERV-----GEDGKTTK 67
            |||| |.| |..||.::|...|.:..|.|.|.:.|.|:|...|:|.|.|.|.     |::...|:
 Worm    10 VFDS-PRG-YAPGQTVTGQVVLRSNEPITARFLKICIHGAAHTKWSEGERRYRTNCEGKEESYTE 72

  Fly    68 SLVTHTTTEVYYSTDQPVYGQAGGSQLELPTGKYVFPFRATIPPNAPTSFNGAHGQIKHEVTLTI 132
              :.|.:.||.|.:.:.:...|.....:||:|.:||||...:|...|.||.|.||.:::.|.:.:
 Worm    73 --IVHYSAEVDYVSGETIAWSARNGTEKLPSGHHVFPFAFPLPIECPPSFEGFHGHVRYSVRVEL 135

  Fly   133 DRAVRYNNTFKQCFTVILPHDLNRRLEYKEPLQRLESKSFWWGSIFGAHKPMIMDVSTSY--SAY 195
            ||..::|...::.|.||...|||.......|....:.|..  |.||   |..|:.::.:.  :.|
 Worm   136 DRPWKFNKNEREDFKVIPNFDLN
HLPLGNVPRMMKDVKDI--GQIF---KKGIVTITVTIPKAGY 195

  Fly   196 VPGQKIHFHLVLDNQSDVQCMDVKVRLIKNVSYRANSSGA-------------KEQLKVTESR-- 245
            .||:.:...:.:||.|......|:..|.::..|.|:.:..             .|..::.|:|  
 Worm   196 APGEYLPITIDIDNASKRAATFVRAELHQHSHYNASKNHGLLCTHSSYHEHHKDESKRIAEARKS 260

  Fly   246 --VADKHCG-EVLKHNKAKFDEFLTVPPTTPSTQSEKDP-IRVSYTLRFIAKTF-----KLHGGG 301
              :|.|..| |:|:         :.:|.:.|:..|   | |.:.|.|.....|.     .||   
 Worm   261 IKIAPKTAGREMLR---------MKIPKSPPTFTS---PIISIEYCLSVRLDTLTTLNNTLH--- 310

  Fly   302 DLVMDFPITIGTVPLLGSADDKGPGAEKSQPSGASHPGSP 341
               .:|.|.|||||:..|.         .:|:..:.|..|
 Worm   311 ---CEFDIIIGTVPITESI---------VEPTVTTFPSDP 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 51/151 (34%)
Arrestin_C 182..313 CDD:280848 33/156 (21%)
arrd-24NP_510328.2 Arrestin_N 7..158 CDD:334019 51/151 (34%)
Arrestin_C 180..321 CDD:214976 35/158 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.