DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and arrd-6

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001254290.1 Gene:arrd-6 / 185541 WormBaseID:WBGene00009579 Length:469 Species:Caenorhabditis elegans


Alignment Length:403 Identity:92/403 - (22%)
Similarity:151/403 - (37%) Gaps:92/403 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LYQAGQLISGTAELITERPKTIRSIFITINGYGETRWQESEERVGEDGKTTKSLVTHTTTEVYYS 80
            :|.||:.|||:..|.......||.|.:.:.|           :|....|..||....|..:..|.
 Worm    42 VYYAGETISGSVLLENTENIKIRGIRVLLRG-----------KVHATLKVVKSGERRTLKDDQYV 95

  Fly    81 TD--QPVYGQAGGSQLE----LPTGKYVFPFRATIPPNA-PTSFNGAHGQIKHEVTLTID----- 133
            .|  |.::|:....:.:    |..|.:.|.|...:|.:: |.|....|..|::...:.||     
 Worm    96 LDEKQLLWGKDKSDESDSVPILARGVHQFSFNFDLPQSSLPCSLESRHCTIRYYFKVIIDIPYAS 160

  Fly   134 --RAVRYNNTFKQCFTVILPHDLNRRLEYKEPLQRLESK-SFWWGSIFGAHKPMIMDVSTSYSAY 195
              :.::|       ||:|.||..:...:|..||...:.| :..|....||   :.:.:....:||
 Worm   161 SPQGIKY-------FTIIGPH
IDSMEEKYLSPLSAQDRKVNCCWCCQRGA---LALRIILERTAY 215

  Fly   196 VPGQKIHFHLVLDN-QSDVQCMDVKVRLIKNVSYRANSSGAKEQLKVTESRVADKHCGEVLKHNK 259
            |.|:.|.....::| ||..|  .:.:||:::|.... ..|...:.|:....|.:.....:..:::
 Worm   216 VCGENIRVRAQIENRQSTAQ--SLVIRLVQHVEVFV-EKGLLGENKMMSCVVFEHKSPAIAANSQ 277

  Fly   260 AKFDEFLTVP---PTTPST-QSEKDPIRVSYTLRFIAKTFKLHGGGDLVMDFPITIGTVPL---- 316
            .|:|..|..|   |..|.| ......|::.|.||...:..|  |...|.:|||:|:.|:|.    
 Worm   278 GKYDSTLEQPIRLPVVPPTLVGVCRLIQIYYALRVCMEDEK--GNECLHIDFPLTVATIPYRIPN 340

  Fly   317 --------------------------LGSA-DDKGPGAEKSQPSGASHP----------GSPNFQ 344
                                      ||.. |.:|....|.:......|          |||:..
 Worm   341 APPPPVDYDFCSNHVEGGKYVSPEFRLGQVYDGEGEEINKEEEIVLYRPVYVKLADRRIGSPHVS 405

  Fly   345 EDVSDEQFESNTF 357
            :|     |.|.:|
 Worm   406 KD-----FRSGSF 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 37/152 (24%)
Arrestin_C 182..313 CDD:280848 33/135 (24%)
arrd-6NP_001254290.1 Arrestin_N 34..174 CDD:278754 35/149 (23%)
Arrestin_C 201..336 CDD:214976 36/142 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.