DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and ttm-2

DIOPT Version :10

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_494855.1 Gene:ttm-2 / 184995 WormBaseID:WBGene00017840 Length:358 Species:Caenorhabditis elegans


Alignment Length:34 Identity:7/34 - (20%)
Similarity:15/34 - (44%) Gaps:0/34 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 SCWAFATVASVEAQNAIKKGKLVSLSEQEMVDCD 224
            :|.|...:|.....||:.:...::|....::..|
 Worm    15 ACEAIGELAVKGVNNALVENSAITLGRLALIRPD 48

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:425619
Arrestin_C 182..316 CDD:460676 7/34 (21%)
PHA03247 <313..450 CDD:223021
ttm-2NP_494855.1 Arrestin_N 7..149 CDD:451447 7/34 (21%)
Arrestin_C <231..326 CDD:214976
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.