DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and arrd-14

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_496881.1 Gene:arrd-14 / 175021 WormBaseID:WBGene00011055 Length:356 Species:Caenorhabditis elegans


Alignment Length:359 Identity:75/359 - (20%)
Similarity:133/359 - (37%) Gaps:105/359 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LYQAGQLISGTAELITERPKTIRSIFITINGYGETRWQESEERVGEDGKTTKSLVTHTTT--EVY 78
            :|..|..:.|.|.:.|.:.....|:.||.:  |:|....:.:::.:|.|..|...|:...  ||:
 Worm    16 VYFPGDEVKGRAWVSTTKNLKATSVEITFS--GKTITAHNGKKIIKDKKCKKGEETYVEMKHEVW 78

  Fly    79 YSTDQPVYGQAGGSQLELPTGKYVFPFRATIPPNAPTSFNGAHGQIKHEVTL----------TID 133
            ...|         ::...|:|.|.:.|...:|.:.|.||.|.:|.|::.|.|          .::
 Worm    79 TPED---------TENTFPSGDYEWNFSFELPKDCPPSFEGKYGFIRYSVLLHIAVPNGKPINVE 134

  Fly   134 RAVRYNNTFKQCFTVILPHDLNRRLEYKEPLQRLESKSFWWGSIFGAHKP--------------- 183
            |||          ||....|||                     ...||:|               
 Worm   135 RAV----------TVSSMVDLN
---------------------AVNAHEPAKIHVDNVAEYCHCL 168

  Fly   184 --------MIMDVSTSYSAYVPGQKIHFHLVLDNQSDVQCMDVKVRLIKNVSYR------AN--- 231
                    :|..:.:....||.|:.:.....::|.:......:..:|.:.::||      ||   
 Worm   169 PCLPTRGNVIYTLQSPKCGYVAGENVIVSGQIENGTSKPMKIITAKLTRRITYREELKAKANAKK 233

  Fly   232 ----SSGAKEQL--KVTESRVADKHCGEVLKHNK---AKFDEFLTVPPTTPSTQSEKDPIRVSYT 287
                :.|.|.:|  ::.|:::  :.|....:.:|   ..||    :|....:.:|.: .:.|.|.
 Worm   234 KADGADGFKSKLEEQILETKI--ERCNVPARSSKDFAFSFD----IPAVVSTIRSSR-LLAVEYF 291

  Fly   288 LRFIAKTFKLHGGGDLVMDFPITIGTVPL-LGSA 320
            :.....|...:.||  |....|.:|.||| |||:
 Worm   292 VTVWGDTGTCNRGG--VAALNIIVGNVPLFLGSS 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 36/150 (24%)
Arrestin_C 182..313 CDD:280848 28/171 (16%)
arrd-14NP_496881.1 Arrestin_N 6..146 CDD:334019 36/150 (24%)
Arrestin_C 173..318 CDD:214976 29/153 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.