DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and Arrdc3

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001036056.1 Gene:Arrdc3 / 105171 MGIID:2145242 Length:414 Species:Mus musculus


Alignment Length:372 Identity:93/372 - (25%)
Similarity:145/372 - (38%) Gaps:54/372 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DSNPLGLYQAGQLISGTAELITERPKTIRSIFITINGYGETRWQESEERVGEDGKTTKSLVTHTT 74
            ||| :.:|.:|..:||...|.......::|:.|...|:.:.||.||...    |..|.....:|.
Mouse    18 DSN-VPVYSSGDTVSGRVNLEVTGEIRVKSLKIHARGHAKVRWTESRNA----GSNTAYTQNYTE 77

  Fly    75 TEVYYSTDQPVYG--------QAGGSQLELPTGKYVFPFRATIPPNAPTSFNGAHGQIKHEVTLT 131
            ...|::....:.|        :.|...:.....:|.|.|.....|.| |||.|.||.:::.|...
Mouse    78 EVEYFNHKDILIGHERDDDNSEEGFHTIHSGRHEYAFSFELPQTPLA-TSFEGRHGSVRYWVKAE 141

  Fly   132 IDRAVRYNNTFKQCFTVILPHDLNRRLEYKEPLQRLESKSFWWGSIFGAHKPMIMDVSTSYSAYV 196
            :.|........|:.|||....|:|............|.....|   |....|:.:........|.
Mouse   142 LHRPWLLPVKLKKEFTVFEHIDINTPSLLSPQAGTKEKTLCCW---FCTSGPISLSAKIERKGYT 203

  Fly   197 PGQKIHFHLVLDNQSDVQCMDVKVRLI--KNVSYRANSSGAKEQLKVTESRVADKHCGEVLKHNK 259
            ||:.|.....::|.|.        |::  |...|:..:..||.::|..:..||:.. ||.|...|
Mouse   204 PGESIQIFAEIENCSS--------RMVVPKAAIYQTQAFYAKGKMKEVKQLVANLR-GESLSSGK 259

  Fly   260 AKF--DEFLTVPPTTPSTQSEKDPIRVSYTLRFIAKTFKLHGGGDLVMDFPITIGTVPL--LGSA 320
            .:.  .:.|.:||.:||. .:...|||.|:|....   .:.|..||::..|:.|||:||  .||.
Mouse   260 TETWNGKLLKIPPVSPSI-LDCSIIRVEYSLMVYV---DIPGAMDLLLSLPLVIGTIPLHPFGSR 320

  Fly   321 DDKGPGAEKSQ------------PSGASHPGSPNFQEDVSDEQFESN 355
                ..:..||            |.....|  |::.|.|::||..:|
Mouse   321 ----TSSVSSQCSMSMNWLALALPERPEAP--PSYAEVVTEEQRRNN 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 39/152 (26%)
Arrestin_C 182..313 CDD:280848 34/134 (25%)
Arrdc3NP_001036056.1 Arrestin_N 22..165 CDD:278754 36/147 (24%)
Arrestin_C 187..314 CDD:214976 36/139 (26%)
PPxY motif 1. /evidence=ECO:0000305 346..349 2/4 (50%)
PPxY motif 2. /evidence=ECO:0000305 391..394
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 393..414
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.