DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and arrdc4

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001107732.1 Gene:arrdc4 / 100135736 XenbaseID:XB-GENE-492296 Length:403 Species:Xenopus tropicalis


Alignment Length:386 Identity:95/386 - (24%)
Similarity:155/386 - (40%) Gaps:89/386 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VNFVFDSNPLGLYQAGQLISGTAELITERPKTIRSIFITINGYGETRWQESEERVGEDGKTTKSL 69
            |..::::.....|.||:.::|...|...|...:.|:.:.:.|...|..|..:.   ||.......
 Frog     7 VTIIYENEGKYGYCAGEPVTGYVLLEVLREIRVLSLLLRVCGGAMTCKQGKQL---EDAWEAFPQ 68

  Fly    70 VTHTTTEVYYSTDQPVYGQAGGSQLEL-PTGKYVFPFRATIPPNAP--TSFNGAHGQIKHEVTLT 131
            .||...|.|....:|    ||..::.| |.|.:..|||..: |.:|  |||:|.:|::.::.|..
 Frog    69 ATHYLNEEYSLLTEP----AGDCEILLFPAGNHKIPFRFQL-PESPLVTSFSGKYGKVYYQTTAV 128

  Fly   132 IDRAVRYNNTFKQCFTVILPHDLNRRLEYKEPLQRLESKSFWWGSIFGAHKPMIMDVSTSYSAYV 196
            :.|.....:|..:...|:.|.::|....| .|::|  ||....|..|....|:.::.......|.
 Frog   129 LKRPSVPPHTTHRELRVLSPINVNSPSLY-TPVER--SKEVMVGCWFFMSGPISVNAKIGRKGYC 190

  Fly   197 PGQKIHFHLVLDN-------------QSDVQCMDVKVRLIKNV--SYRAN--SSGAKEQLKVTES 244
            .|:.||.:..::|             |:....:|.|.|.::.:  |.|.|  :||:         
 Frog   191 NGEAIHIYADIENGSSRLIVPKAAIYQTQSFLLDGKTRTVRQMLASVRGNHIASGS--------- 246

  Fly   245 RVADKHCGEVLKHNKAKFDEFLTVPPTTPSTQSEKDPIRVSYTLRFIAKTFKLHGGGDLVMDFPI 309
              ||...|:.||           :||.|||. .|.:.|||.|:|   |.:..:.|...|.::.|:
 Frog   247 --ADSWNGKALK-----------IPPVTPSI-LECNIIRVEYSL---AVSINIPGAKKLKVELPL 294

  Fly   310 TIGTVPL--------------------LGSADDKGPGAEKSQPSGASHPGSPNFQEDVSDE 350
            .|||:||                    |..|..:.|.|            .||:.:.||:|
 Frog   295 VIGTIPLNEFNCRNASVASQFSMDMSWLALALPEQPEA------------PPNYADIVSEE 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 38/152 (25%)
Arrestin_C 182..313 CDD:280848 36/147 (24%)
arrdc4NP_001107732.1 Arrestin_N 7..152 CDD:304627 38/152 (25%)
Arrestin_C 175..301 CDD:214976 38/151 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.