DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and LEU5

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_011865.1 Gene:LEU5 / 856391 SGDID:S000001044 Length:357 Species:Saccharomyces cerevisiae


Alignment Length:345 Identity:90/345 - (26%)
Similarity:148/345 - (42%) Gaps:79/345 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTS-----KYTS--IG--QAVKT 88
            ||||:|.:..::...|||.:||.||                  ||     |||.  ||  :|.|.
Yeast    38 LAGGISGSCAKTLIAPLDRIKILFQ------------------TSNPHYTKYTGSLIGLVEAAKH 84

  Fly    89 IYREEGMLAFWKGHNPAQVLSIMYGICQFWTYEQLS---LMAKQTSYLADHQHLSNFLCGAAAGG 150
            |:..:|:..|::||:...:....|...:|..|||:.   :.:|:.     ..|....:.|:.||.
Yeast    85 IWINDGVRGFFQGHSATLLRIFPYAAVKFVAYEQIRNTLIPSKEF-----ESHWRRLVSGSLAGL 144

  Fly   151 AAVIISTPLDVIRTRLIAQDTSKGYRNATRAVSAIVRQEGPR----------------GMYRGLS 199
            .:|.|:.|||::|.|| |.:|........|.:..|.::....                ..|||..
Yeast   145 CSVFITYPLDLVRVRL-AYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYV 208

  Fly   200 SALLQITPLMGTNFMAYRLFSD-------WACAFLEVSD-----------RSQLPTWTLLGLGAS 246
            ..:|.:.|..|.:|.|:.|..|       ...:.||:|:           |..|.||..|..|..
Yeast   209 PTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKKQRRPLRTWAELISGGL 273

  Fly   247 SGMLSKTIVYPFDLIKKRLQIQGFESNRQTFGQTLQCH---GVWDCLRLTVRQEGVRGLYKGVAP 308
            :||.|:|..|||::|::|||:.....      :|:..|   .:.:...:..::.||||.:.|::.
Yeast   274 AGMASQTAAYPFEIIRRRLQVSALSP------KTMYDHKFQSISEIAHIIFKERGVRGFFVGLSI 332

  Fly   309 TLLKSSMTTALYFSIYDKLK 328
            ..:|.:...|..|.:|:::|
Yeast   333 GYIKVTPMVACSFFVYERMK 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 30/98 (31%)
PTZ00169 33..329 CDD:240302 90/345 (26%)
Mito_carr 153..222 CDD:278578 22/91 (24%)
Mito_carr 233..328 CDD:278578 27/97 (28%)
LEU5NP_011865.1 Mito_carr 32..127 CDD:395101 31/106 (29%)
PTZ00169 38..329 CDD:240302 84/320 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0752
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.