DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and Slc25a16

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_780403.1 Gene:Slc25a16 / 73132 MGIID:1920382 Length:332 Species:Mus musculus


Alignment Length:357 Identity:98/357 - (27%)
Similarity:155/357 - (43%) Gaps:58/357 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVTTGSTSEATTTTTP-VPRRKHS----TREQ---LHQMLAGGLSAAITRSTCQPLDVLKIRFQ 57
            ||....:.:.|.....| ||:...|    :|..   |...||||::....::|..|||.:|:..|
Mouse     1 MAALVAAAALAAAEPAPAVPQAAGSGGPTSRRDFYWLRSFLAGGIAGCCAKTTVAPLDRVKVLLQ 65

  Fly    58 LQVEPLGKNAAKEGPGALTSKYTSIG--QAVKTIYREEGMLAFWKGHNPAQVLSIMYGICQFWTY 120
                            |....|..:|  ..::.:.::||.|..:||:....:....||..||..:
Mouse    66 ----------------AHNRHYKHLGVLSTLRAVPQKEGYLGLYKGNGAMMIRIFPYGAIQFMAF 114

  Fly   121 EQLSLMAKQTSYLADHQHLSNFLCGAAAGGAAVIISTPLDVIRTRLIAQDTSKG---YRNATRAV 182
            |......  |:.|....|:...:.|:.||..|||.:.||||:|.||..|  .||   |.....|.
Mouse   115 EHYKTFI--TTKLGVSGHVHRLMAGSMAGMTAVICTYPLDVVRVRLAFQ--VKGEHTYSGIIHAF 175

  Fly   183 SAIVRQEGP-RGMYRGLSSALLQITPLMGTNFMAYRLFS----DWACAFL--EVSDRSQ---LPT 237
            ..|..:||. .|.||||...:|.:.|..|.:|..:....    .:|.|.|  ..||...   |.|
Mouse   176 KTIYAKEGGFLGFYRGLMPTILGMAPYAGVSFFTFGTLKSVGLSYAPALLGRPSSDNPNVLVLKT 240

  Fly   238 WTLLGLGASSGMLSKTIVYPFDLIKKRLQIQG----FESNRQTFGQTLQCHGVWDCLRLTVRQEG 298
            ...|..|..:|.:::||.||||:.::|:|:..    ||          :|..:.:.::....|.|
Mouse   241 HINLLCGGVAGAIAQTISYPFDVTRRRMQLGAVLPEFE----------KCLTMRETMKYVYGQHG 295

  Fly   299 V-RGLYKGVAPTLLKSSMTTALYFSIYDKLKQ 329
            : ||||:|::...::...:.|:.|:.|:.:||
Mouse   296 IRRGLYRGLSLNYIRCIPSQAVAFTTYELMKQ 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 24/95 (25%)
PTZ00169 33..329 CDD:240302 87/315 (28%)
Mito_carr 153..222 CDD:278578 26/76 (34%)
Mito_carr 233..328 CDD:278578 26/102 (25%)
Slc25a16NP_780403.1 Mito_carr 33..125 CDD:278578 25/109 (23%)
Solcar 1 34..120 24/101 (24%)
PTZ00169 36..330 CDD:240302 90/322 (28%)
Solcar 2 128..216 31/89 (35%)
Mito_carr 131..214 CDD:278578 30/84 (36%)
Mito_carr 238..330 CDD:278578 28/100 (28%)
Solcar 3 238..328 28/100 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0752
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.