DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and Slc25a42

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001007571.1 Gene:Slc25a42 / 73095 MGIID:1920345 Length:318 Species:Mus musculus


Alignment Length:343 Identity:97/343 - (28%)
Similarity:152/343 - (44%) Gaps:66/343 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AVTTGSTSEATTTTTPVPRRKHSTREQLHQMLAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKN 66
            ||..|:.|.         :|.|  |:.|..:|:|.|:.|:.::...|||..||.||         
Mouse    18 AVLAGAVSS---------KRDH--RQVLSSLLSGALAGALAKTAVAPLDRTKIIFQ--------- 62

  Fly    67 AAKEGPGALTSKYTSIGQAVKTI---YREEGMLAFWKGHNPAQVLSIMYGICQFWTYEQLSLMAK 128
                    ::||..|..:|.:.:   |..||.|:.|:|::...|..|.|...||..:|:      
Mouse    63 --------VSSKRFSAKEAFRLLYFTYLNEGFLSLWRGNSATMVRVIPYAAIQFSAHEE------ 113

  Fly   129 QTSYLADHQHLSNF-----------LCGAAAGGAAVIISTPLDVIRTRLIAQDTSKGYRNATRAV 182
               |.....|...|           |.||.||..|..::.|||::|.|: |....:.|.|.....
Mouse   114 ---YKRILGHYYGFRGEALPPWPRLLAGALAGTTAASLTYPLDLVRARM-AVTPKEMYSNIFHVF 174

  Fly   183 SAIVRQEGPRGMYRGLSSALLQITPLMGTNFMAYRLFSDWACAFLEVSDRSQLPTWTLLGLGASS 247
            ..|.|:||.:.:|.|.:..:|.:.|..|.:|..|.....   ...|.|.|.|...:..:..||.:
Mouse   175 IRISREEGLKTLYFGFTPTVLGVIPYAGLSFFTYESLKS---LHREYSGRPQPYPFERMVFGACA 236

  Fly   248 GMLSKTIVYPFDLIKKRLQIQGFESNRQTFGQTLQCHG-VWDCLRLTVRQEG-VRGLYKGVAPTL 310
            |::.::..||.|::::|:         ||.|.|...|| :...||..||:|| |||||||::...
Mouse   237 GLIGQSASYPLDVVRRRM---------QTAGVTGHQHGSILSTLRSIVREEGAVRGLYKGLSMNW 292

  Fly   311 LKSSMTTALYFSIYDKLK 328
            ||..:...:.|:.:|.::
Mouse   293 LKGPIAVGISFTTFDLMQ 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 28/96 (29%)
PTZ00169 33..329 CDD:240302 89/312 (29%)
Mito_carr 153..222 CDD:278578 19/68 (28%)
Mito_carr 233..328 CDD:278578 31/96 (32%)
Slc25a42NP_001007571.1 Solcar 1 31..117 30/111 (27%)
PTZ00169 34..295 CDD:240302 87/299 (29%)
Solcar 2 129..214 25/88 (28%)
Solcar 3 224..312 30/96 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0752
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.