DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and Slc25a42

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_006253013.1 Gene:Slc25a42 / 689414 RGDID:1592346 Length:329 Species:Rattus norvegicus


Alignment Length:229 Identity:63/229 - (27%)
Similarity:97/229 - (42%) Gaps:43/229 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AVTTGSTSEATTTTTPVPRRKHSTREQLHQMLAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKN 66
            :|..|..:||........:|.|  |:.|..:|:|.|:.|:.::...|||..||.||         
  Rat    54 SVRLGEDAEAVLAGAVSTKRDH--RQVLSSLLSGALAGALAKTAVAPLDRTKIIFQ--------- 107

  Fly    67 AAKEGPGALTSKYTSIGQAVKTI---YREEGMLAFWKGHNPAQVLSIMYGICQFWTYEQLSLMAK 128
                    ::||..|..:|.:.:   |..||.|:.|:|::...|..|.|...||..:|:      
  Rat   108 --------VSSKRFSAKEAFRLLYFTYLNEGFLSLWRGNSATMVRVIPYAAIQFSAHEE------ 158

  Fly   129 QTSYLADHQHLSNF-----------LCGAAAGGAAVIISTPLDVIRTRLIAQDTSKGYRNATRAV 182
               |.....|...|           |.||.||..|..::.|||::|.|: |....:.|.|.....
  Rat   159 ---YKRILGHYYGFRGEALPPWPRLLAGALAGTTAASLTYPLDLVRARM-AVTPKEMYSNIFHVF 219

  Fly   183 SAIVRQEGPRGMYRGLSSALLQITPLMGTNFMAY 216
            ..|.|:||.:.:|.|.:..:|.:.|..|.:|..|
  Rat   220 IRISREEGLKTLYFGFTPTVLGVIPYAGLSFFTY 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 28/96 (29%)
PTZ00169 33..329 CDD:240302 55/198 (28%)
Mito_carr 153..222 CDD:278578 19/64 (30%)
Mito_carr 233..328 CDD:278578
Slc25a42XP_006253013.1 Mito_carr 74..167 CDD:278578 32/120 (27%)
Mito_carr <192..259 CDD:278578 19/63 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0752
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.