DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and slc25a19

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_012827197.1 Gene:slc25a19 / 548707 XenbaseID:XB-GENE-5868233 Length:329 Species:Xenopus tropicalis


Alignment Length:294 Identity:126/294 - (42%)
Similarity:171/294 - (58%) Gaps:10/294 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKTIYREEGMLA 97
            :||.||..:||:...||||:|||||||:|.|..:..:       .||..|.|||..|.||||:..
 Frog    25 MAGSLSGLVTRALISPLDVIKIRFQLQIESLSSHGTQ-------GKYHGILQAVGLILREEGLPG 82

  Fly    98 FWKGHNPAQVLSIMYGICQFWTYEQLSLMAKQTSYLADHQHLSNFLCGAAAGGAAVIISTPLDVI 162
            |||||.|||:||:.||..||.::|.|:.:...::.|.......:||||..|..:|.:...|||.:
 Frog    83 FWKGHVPAQLLSVSYGAVQFVSFEMLTELFHVSTSLDPRSPAVHFLCGGLAACSATLAVQPLDTL 147

  Fly   163 RTRLIAQDTSKGYRNATRAVSAIVRQEGPRGMYRGLSSALLQITPLMGTNFMAYRLFS-DWACAF 226
            |||..||...|.|||...|:..:.|.|||...||||...||.:.|..|..|.:|.|.. .|....
 Frog   148 RTRFAAQGEPKVYRNLRNAIFTMFRTEGPVAFYRGLFPTLLAVFPYAGLQFSSYNLLKRTWNLVL 212

  Fly   227 LEVSDRSQLPTWTLLGLGASSGMLSKTIVYPFDLIKKRLQIQGFESNRQTFGQTLQCHGVWDCLR 291
            |:  |::|..:...|..|:.:|::|||:.|||||.|||||:.|||..|..||:....||:.||..
 Frog   213 LK--DQTQKDSLRNLLCGSGAGVISKTVTYPFDLFKKRLQVGGFEQARAHFGKVRTYHGLVDCAC 275

  Fly   292 LTVRQEGVRGLYKGVAPTLLKSSMTTALYFSIYD 325
            ...::||.||.:||:||:|||::.:|.|.|..|:
 Frog   276 QIWKEEGFRGFFKGLAPSLLKAAFSTGLTFFSYE 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 45/89 (51%)
PTZ00169 33..329 CDD:240302 126/294 (43%)
Mito_carr 153..222 CDD:278578 28/69 (41%)
Mito_carr 233..328 CDD:278578 42/93 (45%)
slc25a19XP_012827197.1 Mito_carr 18..113 CDD:365909 46/94 (49%)
Mito_carr 122..208 CDD:365909 34/85 (40%)
Mito_carr 222..311 CDD:365909 41/88 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I7740
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H5982
Inparanoid 1 1.050 228 1.000 Inparanoid score I3382
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1454699at2759
OrthoFinder 1 1.000 - - FOG0001923
OrthoInspector 1 1.000 - - otm48924
Panther 1 1.100 - - LDO PTHR24089
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2969
SonicParanoid 1 1.000 - - X2188
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.