DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and CG4743

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster


Alignment Length:342 Identity:79/342 - (23%)
Similarity:130/342 - (38%) Gaps:75/342 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVTTGSTSEATTTT----TPVPRRKHSTREQLHQMLAGGLSAAITRSTCQPLDVLKIRFQLQVE 61
            ||...|..|.|.:..    .||.:.|.     .|.::|||::..:......|:|.:|.|.|.:  
  Fly     1 MAAELGLESAAGSVAIKMQEPVNKLKF-----FHALVAGGVAGMVVDIALFPIDTVKTRLQSE-- 58

  Fly    62 PLGKNAAKEGPGALTSKYTSIGQAVKTIYREEGMLAFWKGHNPAQVLSIMYGICQFWTYEQLSLM 126
             ||                        .:|..|....:||..||...|.......|.|||.....
  Fly    59 -LG------------------------FWRAGGFRGIYKGLAPAAAGSAPTAALFFCTYECGKQF 98

  Fly   127 AKQTSYLADHQHLSNFLCGAAAGGAAVIISTPLDVIRTRLIAQDTSKGYRNATRAVSAIVRQEG- 190
            ....:...|..:: :....:||...|.:|..|:::.:.|  :|......::..:.:....|.|| 
  Fly    99 LSSVTQTKDSPYV-HMAAASAAEVLACLIRVPVEIAKQR--SQTLQGNKQSGLQILLRAYRTEGL 160

  Fly   191 PRGMYRGLSSALLQITPLMGTNFMAYRLFSDWACAFLEVSDRSQLPTWT-LLGL----------G 244
            .||:|||..|.:::..|.....|..:..|.      |:         || |.|.          |
  Fly   161 KRGLYRGFGSTIMREIPFSLIQFPLWEYFK------LQ---------WTPLTGFDSTPFSVALCG 210

  Fly   245 ASSGMLSKTIVYPFDLIKKRLQIQGFES-NRQTFGQTLQCHGVWDCLRLTVRQEGVRGLYKGVAP 308
            |.:|.:|..:..|.|::|.|:.:...|| ||:...:.: .||::       .:.|..||:.|..|
  Fly   211 AVAGGISAGLTTPLDVVKTRIMLAERESLNRRRSARRI-LHGIY-------LERGFSGLFAGFVP 267

  Fly   309 TLLKSSMTTALYFSIYD 325
            .:|..::..|.:|..||
  Fly   268 RVLWITLGGAFFFGFYD 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 22/93 (24%)
PTZ00169 33..329 CDD:240302 70/306 (23%)
Mito_carr 153..222 CDD:278578 16/69 (23%)
Mito_carr 233..328 CDD:278578 28/105 (27%)
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 23/107 (21%)
PTZ00168 25..281 CDD:185494 69/313 (22%)
Mito_carr 199..291 CDD:278578 24/94 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441586
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.