DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and DPCoAC

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster


Alignment Length:348 Identity:89/348 - (25%)
Similarity:155/348 - (44%) Gaps:70/348 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TTGSTSEATTTTTPVPRRKHSTREQLHQ----MLAGGLSAAITRSTCQPLDVLKIRFQLQVE-PL 63
            |:|......||.||:       |:::.|    :::|..:.|:.::...|||..||.||::.: |.
  Fly    51 TSGVVLVPATTVTPM-------RQKIDQVVISLISGAAAGALAKTVIAPLDRTKINFQIRNDVPF 108

  Fly    64 GKNAAKEGPGALTSKYTSIGQAVKTIYREEGMLAFWKGHNPAQVLSIMYGICQFWTYEQLSLMAK 128
            ...|        :.:|      ::..|..||:||.|:|::......:.|...||..:||...:. 
  Fly   109 SFRA--------SLRY------LQNTYANEGVLALWRGNSATMARIVPYAAIQFTAHEQWRRIL- 158

  Fly   129 QTSYLADHQHLS---------NFLCGAAAGGAAVIISTPLDVIRTRLIAQDTSKGYRNATRAVSA 184
                     |:.         .||.|:.||..:..::.|||:.|.|:...|...|||...:..:.
  Fly   159 ---------HVDKDGTNTKGRRFLAGSLAGITSQSLTYPLDLARARMAVTDRYTGYRTLRQVFTK 214

  Fly   185 IVRQEGPRGMYRGLSSALLQITPLMGTNFMAYRLFSDWACAFLEVSDRSQLPTWTLLGLGASSGM 249
            |..:||||.::||..:.:|.:.|..||:|..|.....   .:.||...::..|...|..||::|.
  Fly   215 IWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKR---EYYEVVGNNKPNTLVSLAFGAAAGA 276

  Fly   250 LSKTIVYPFDLIKKRLQIQGFESNRQTFGQTLQCH--------GVWDCLRLTVRQEGVR-GLYKG 305
            ..:|..||.|::::|:             ||::.:        .:.:.|....|:|||: |.|||
  Fly   277 AGQTASYPLDIVRRRM-------------QTMRVNTAGGDRYPTILETLVKIYREEGVKNGFYKG 328

  Fly   306 VAPTLLKSSMTTALYFSIYDKLK 328
            ::...:|..:...:.||.||.:|
  Fly   329 LSMNWIKGPIAVGISFSTYDLIK 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 24/98 (24%)
PTZ00169 33..329 CDD:240302 81/315 (26%)
Mito_carr 153..222 CDD:278578 22/68 (32%)
Mito_carr 233..328 CDD:278578 26/103 (25%)
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 24/110 (22%)
Mito_carr 169..251 CDD:278578 27/81 (33%)
Mito_carr 279..356 CDD:278578 22/86 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441606
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0752
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24089
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.