DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and GC2

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster


Alignment Length:312 Identity:70/312 - (22%)
Similarity:127/312 - (40%) Gaps:88/312 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QMLAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKTIYREEGM 95
            :::.||::..|..:...|||::|.|  ||.:.:|.|..:        .||||....:.....||.
  Fly    23 KIINGGVAGIIGVACVYPLDMVKTR--LQNQTIGPNGER--------MYTSIADCFRKTIASEGY 77

  Fly    96 LAFWKGH-------NPAQVLSIMYGICQFWTYEQLSLMAKQTSYLADHQHLSN----------FL 143
            ...::|.       .|.:.:.:...  .|:.|                 ||::          .|
  Fly    78 FGMYRGSAVNIVLITPEKAIKLTAN--DFFRY-----------------HLASDDGVIPLSRATL 123

  Fly   144 CGAAAGGAAVIISTPLDVIRT------RLIAQDTSKGYR----NATRAVSAIVRQEGPRGMYRGL 198
            .|..||...::::||:::::.      |:.|.|.:.|..    .|......::|:.|..|:|:|:
  Fly   124 AGGLAGLFQIVVTTPMELLKIQMQDAGRVAAADRAAGREVKTITALGLTKTLLRERGIFGLYKGV 188

  Fly   199 SSALLQITPLMGTNF-MAYRLFSDWACAFLEVSDRSQLPT---------WTLLGLGASSGMLSKT 253
            .:     |.:....| |.|.....|      ::|:....:         |:|:. |..|||.|..
  Fly   189 GA-----TGVRDITFSMVYFPLMAW------INDQGPRKSDGSGEAVFYWSLIA-GLLSGMTSAF 241

  Fly   254 IVYPFDLIKKRLQIQGFESNRQTFGQTLQCHGVWDCLRLTVRQEGVRGLYKG 305
            :|.|||::|.|||..|.:..:          |:.||:..|:::||:...:||
  Fly   242 MVTPFDVVKTRLQADGEKKFK----------GIMDCVNRTLKEEGISAFFKG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 22/98 (22%)
PTZ00169 33..329 CDD:240302 70/310 (23%)
Mito_carr 153..222 CDD:278578 16/79 (20%)
Mito_carr 233..328 CDD:278578 24/82 (29%)
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 70/312 (22%)
Mito_carr 16..106 CDD:278578 21/94 (22%)
Mito_carr 123..203 CDD:278578 19/84 (23%)
Mito_carr 228..302 CDD:278578 23/67 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441603
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.