DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and GC1

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster


Alignment Length:361 Identity:86/361 - (23%)
Similarity:152/361 - (42%) Gaps:89/361 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SEATTTTTPVPRRKHSTREQLHQMLAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPG 73
            |.:.|..||:|:.:|.....|.:::.||::..|..:...|||::|.|  ||.:.:|.|..:    
  Fly     2 SSSATIATPLPQPQHQQFALLPKIINGGIAGIIGVTCVFPLDLVKTR--LQNQQIGPNGER---- 60

  Fly    74 ALTSKYTSIGQAVKTIYREEGMLAFWKGHNPAQVLSIMYGICQFWTYEQ-LSLMA------KQTS 131
                .|.|:....:..|:.||....::| :...:|.|        |.|: :.|.|      |.|:
  Fly    61 ----MYNSMFDCFRKTYKAEGYFGMYRG-SGVNILLI--------TPEKAIKLTANDYFRHKLTT 112

  Fly   132 YLADHQHLSNFLCGAAAGGAAVIISTPLDVIRTRLIAQDTSKGYR------------NATRAVSA 184
            ........|..:.|..||...:|::||:::::.::  ||..:...            :||:..|.
  Fly   113 KDGKLPLTSQMVAGGLAGAFQIIVTTPMELLKIQM--QDAGRVAAAAKLAGKTVEKVSATQLASQ 175

  Fly   185 IVRQEGPRGMYRGL-SSALLQIT------PLMGT-NFMAYR--------LFSDWACAFLEVSDRS 233
            :::.:|..|:|:|: ::.|..:|      ||..| |.:..|        :|  | |:||      
  Fly   176 LIKDKGIFGLYKGIGATGLRDVTFSIIYFPLFATLNDLGPRRNDGSGEAVF--W-CSFL------ 231

  Fly   234 QLPTWTLLGLGASSGMLSKTIVYPFDLIKKRLQIQGFESNRQTFGQTLQCHGVWDCLRLTVRQEG 298
                     .|.::|..:...|.|||::|.|||........:.|      .|:.||:..|::.||
  Fly   232 ---------AGLAAGSTAALAVNPFDVVKTRLQAIKKADGEKEF------KGISDCITKTLKHEG 281

  Fly   299 VRGLYKG-------VAPTLLKSSMTTALYFSIYDKL 327
            ....:||       :||  |.....|..|..:.:.|
  Fly   282 PTAFFKGGLCRMIVIAP--LFGIAQTVYYLGVAEGL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 23/94 (24%)
PTZ00169 33..329 CDD:240302 79/337 (23%)
Mito_carr 153..222 CDD:278578 20/96 (21%)
Mito_carr 233..328 CDD:278578 25/102 (25%)
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 23/95 (24%)
Mito_carr 115..213 CDD:278578 22/99 (22%)
Mito_carr 226..307 CDD:278578 28/106 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441602
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.