DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and CG16736

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster


Alignment Length:247 Identity:56/247 - (22%)
Similarity:86/247 - (34%) Gaps:54/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 HSTREQLHQM--------LAG---GLSAAITRSTCQPLDVLKIRFQLQ-------VEP------L 63
            |.:|..::.|        |.|   |:.||..|.|...:....:.:.||       ::|      |
  Fly    33 HHSRLSINHMFRLMARHGLPGFYYGIVAACLRCTVHTMSTYTLFYNLQDNKYVLMLQPYNTSMVL 97

  Fly    64 GKNAAKEGPGALT-SKYTSIGQA--VKTIYREEGMLAFWKGHNPAQVLSIMYGICQF------WT 119
            |......|..|.. :|...|.||  .:..|.......||:|      |..||....|      |.
  Fly    98 GITGFWGGVLATPFAKLAVIRQADLTRGSYERRNYRNFWRG------LKCMYAKGGFTYLFTGWK 156

  Fly   120 YEQLSLMAKQTSY--LADHQH-------------LSNFLCGAAAGGAAVIISTPLDVIRTRLIAQ 169
            ...:|..|....|  ::|..|             ||:.:..|..|....:|.||:|.:.|..:.:
  Fly   157 INSISSTAVAVLYTPISDKVHTVISWFHRLDEPWLSDLITMALTGSIITVIMTPVDALATLTLNE 221

  Fly   170 DTSKGYRNATRAVSAIVRQEGPRGMYRGLSSALLQITPLMGTNFMAYRLFSD 221
            .:..|..:.......|:|:.|.:|.:.|...||:.:.|........||...|
  Fly   222 SSHYGRTSYPYLYRKIIRKHGYKGFFFGWKPALMALIPHTVLATFVYRFLLD 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 28/126 (22%)
PTZ00169 33..329 CDD:240302 53/229 (23%)
Mito_carr 153..222 CDD:278578 17/69 (25%)
Mito_carr 233..328 CDD:278578
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 11/47 (23%)
Mito_carr 187..277 CDD:278578 21/87 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441579
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.