DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and Mpcp2

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster


Alignment Length:337 Identity:74/337 - (21%)
Similarity:130/337 - (38%) Gaps:59/337 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EATTTTTPVPRRKHSTREQLHQMLA----GG-LSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAK 69
            :.....|||..::.|......:..|    || ||...|.:...|||::|.|.|:.          
  Fly    39 QIAAAATPVANQQDSCEFGSTKYFALCGIGGILSCGTTHTFVVPLDLVKCRLQVD---------- 93

  Fly    70 EGPGALTSKYTSIGQAVKTIYREEGMLAFWKGHNPAQVLSIMYGICQFWTYE-----QLSLMAKQ 129
                  .:||.::....|....|||.....||..|..:.....|:|:|..||     ...::.::
  Fly    94 ------QAKYKNLVHGFKVTVAEEGARGLAKGWFPTLLGYSAQGLCKFGLYELFKVKYAEIIGEE 152

  Fly   130 TSYLADHQHLSNFL-CGAAAGGAAVIISTPLDVIRTRLIAQDTSKGYRNATR-AVSAIVRQEGPR 192
            .:||   ...|.:| ..|:|...|.|...|.:..:.::   .|..||.|..| ||..::::||..
  Fly   153 NAYL---YRTSLYLAASASAEFFADIALAPFEAAKVKI---QTIPGYANNFREAVPKMLKEEGVN 211

  Fly   193 GMYRGLSSALLQITPLMGTNFMAYRLFSDWACAFLEVSDRSQLPTWTLL----GLGASSGMLSKT 253
            ..|:||....::..|.....|..:....:....::....|:.......|    ..|..:|:....
  Fly   212 AFYKGLVPLWMRQIPYTMMKFACFERTVELLYKYVVPKPRADCTKGEQLIVTFAAGYIAGVFCAV 276

  Fly   254 IVYPFDLIKKRL-QIQGFESNRQTFGQTLQCHGVWDCLRLTVRQE-GVRGLYKGVAPTLLKSSMT 316
            :.:|.|::..:| |.:|..:                   ::|.:. |..|::.|:.|.::.....
  Fly   277 VSHPADVVVSKLNQAKGASA-------------------ISVAKSLGFSGMWNGLTPRIIMIGTL 322

  Fly   317 TALYFSIYDKLK 328
            |||.:.|||.:|
  Fly   323 TALQWFIYDGVK 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 26/103 (25%)
PTZ00169 33..329 CDD:240302 70/314 (22%)
Mito_carr 153..222 CDD:278578 16/69 (23%)
Mito_carr 233..328 CDD:278578 19/100 (19%)
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 26/99 (26%)
Mito_carr <175..245 CDD:278578 16/72 (22%)
Mito_carr 260..338 CDD:278578 20/94 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441569
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.