DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and SCaMC

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster


Alignment Length:306 Identity:86/306 - (28%)
Similarity:142/306 - (46%) Gaps:34/306 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 MLAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKTIYREEGML 96
            ::|||::.|::|:...|||.:|:..|:|.:.:|                 |.:.:..:..|.|..
  Fly   289 LVAGGIAGAVSRTCTAPLDRIKVYLQVQTQRMG-----------------ISECMHIMLNEGGSR 336

  Fly    97 AFWKGHNPAQVLSIMYGIC-QFWTYEQLSLMAKQTSYLADHQHLSNFLCGAAAGGAAVIISTPLD 160
            :.|:| |...||.|..... :|..|||:..:.:..........:..|..||||||.:..|..|::
  Fly   337 SMWRG-NGINVLKIAPETAFKFAAYEQMKRLIRGDDGSRQMSIVERFYAGAAAGGISQTIIYPME 400

  Fly   161 VIRTRLIAQDTSKGYRNATRAVSAIVRQEGPRGMYRGLSSALLQITPLMGTNFMAYRLFSDWACA 225
            |::|||..:.|.: |.....|...|.:|||.|..|||....:|.|.|..|.:...|.....   .
  Fly   401 VLKTRLALRRTGQ-YAGIADAAVKIYKQEGVRSFYRGYVPNILGILPYAGIDLAVYETLKR---R 461

  Fly   226 FLEVSDRSQLPTW-TLLGLGASSGMLSKTIVYPFDLIKKRLQIQGFE--SNRQTFGQ----TLQC 283
            ::...|.::.|:: .||..|::|..|.:...||..|::.|||.|..|  :|::...|    :...
  Fly   462 YIANHDNNEQPSFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPLKSSDA 526

  Fly   284 HG----VWDCLRLTVRQEGVRGLYKGVAPTLLKSSMTTALYFSIYD 325
            |.    :....|..|||||:.|||:|:.|..||.....::.:.:|:
  Fly   527 HSGEETMTGLFRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYE 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 24/91 (26%)
PTZ00169 33..329 CDD:240302 86/305 (28%)
Mito_carr 153..222 CDD:278578 22/68 (32%)
Mito_carr 233..328 CDD:278578 31/104 (30%)
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 25/98 (26%)
Mito_carr 375..463 CDD:278578 29/91 (32%)
Mito_carr 470..581 CDD:278578 31/103 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441616
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24089
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.