DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and Bmcp

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster


Alignment Length:319 Identity:82/319 - (25%)
Similarity:132/319 - (41%) Gaps:53/319 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKTIYREEGMLAFW 99
            ||:::........|:|..|.|.|:|.:.:.::.::       .:|..:..|...|.||||:.|.:
  Fly    13 GGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQ-------LRYRGMTDAFVKISREEGLRALY 70

  Fly   100 KGHNPAQVLSIMYGICQFWTYEQLSLMAKQTSYL----ADHQHLSNFLCGAAAGGAAVIISTPLD 160
            .|..||.:....||..:|.||..|..:|.:...|    ...:..||.||.||||..:..|:.|.|
  Fly    71 SGIWPAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTD 135

  Fly   161 VIRTRLIAQDTSKG-YRNATRAVSAIVRQEGPRGMYRGLSSALLQITPLMGTNFMAYRLFSDWAC 224
            |::.|:  |...|| ::........|.:.||.||::||:.....:...:              |.
  Fly   136 VLKVRM--QVHGKGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVI--------------AS 184

  Fly   225 AFLEVSDRSQLPTWTLLGLGASSGMLSKTIV--------YPFDLIKKRLQIQGFESNRQTFGQTL 281
            ..|.|.|..:|......|....:..:|..|.        .|.|:|:.||.      |::....|:
  Fly   185 VELPVYDFCKLQLMNAFGDHVGNHFISSFIASLGSAIASTPIDVIRTRLM------NQRPVSITM 243

  Fly   282 Q-----------CHGVWDCLRLTVRQEGVRGLYKGVAPTLLKSSMTTALYFSIYDKLKQ 329
            .           ..|..||...|:|.||:..||||..||.::......::|..|::||:
  Fly   244 NGVVTAAATPKLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 24/87 (28%)
PTZ00169 33..329 CDD:240302 81/317 (26%)
Mito_carr 153..222 CDD:278578 15/69 (22%)
Mito_carr 233..328 CDD:278578 26/113 (23%)
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 25/90 (28%)
Mito_carr <132..199 CDD:278578 19/82 (23%)
Mito_carr 204..303 CDD:278578 26/105 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441618
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.