DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and PMP34

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster


Alignment Length:311 Identity:74/311 - (23%)
Similarity:140/311 - (45%) Gaps:43/311 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKTIYREEGMLA 97
            ::|.....|..||..|||.  :|.:||:|..|             ...|..|.:|.|...||..:
  Fly    20 VSGAAGGCIAMSTFYPLDT--VRSRLQLEEAG-------------DVRSTRQVIKEIVLGEGFQS 69

  Fly    98 FWKGHNPAQVLSIMYGIC-----QFWTYEQLSLMAKQTSYLADHQHLSNFLCGAAAGGAAVIIST 157
            .::|..|     ::..:|     .|:|:..|..:|...| .:.|..|.:.|.|:.||...|:.:|
  Fly    70 LYRGLGP-----VLQSLCISNFVYFYTFHALKAVASGGS-PSQHSALKDLLLGSIAGIINVLTTT 128

  Fly   158 PLDVIRTRL-------IAQDTSKGYRNATRAVSAIVRQEGPRGMYRG-LSSALLQITPLMGTNFM 214
            |..|:.|||       .:.:.:|.|:|....:..:..:||..|::.| :.|.:|...|.:  .||
  Fly   129 PFWVVNTRLRMRNVAGTSDEVNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSLMLVSNPAL--QFM 191

  Fly   215 AYRLFSDWACAFLEVSDRSQLPTWTLLGLGASSGMLSKTIVYPFDLIKKRLQIQGFESNRQ---T 276
            .|.:.......|    ...::.:.:...:||.:...:..:.||..|::.:.:.:..||:.:   :
  Fly   192 MYEMLKRNIMRF----TGGEMGSLSFFFIGAIAKAFATVLTYPLQLVQTKQRHRSKESDSKPSTS 252

  Fly   277 FGQTLQCHGVWDCLRLTVRQEGVRGLYKGVAPTLLKSSMTTALYFSIYDKL 327
            .|.|.:.....:.:...::.:|:|||::|:...:|::.:|.||.|..|:|:
  Fly   253 AGSTPRTESTLELMISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYEKI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 23/94 (24%)
PTZ00169 33..329 CDD:240302 74/311 (24%)
Mito_carr 153..222 CDD:278578 20/76 (26%)
Mito_carr 233..328 CDD:278578 21/98 (21%)
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 23/95 (24%)
Mito_carr 105..202 CDD:278578 26/98 (27%)
Mito_carr 214..303 CDD:278578 20/88 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441590
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.