DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and sea

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster


Alignment Length:336 Identity:92/336 - (27%)
Similarity:143/336 - (42%) Gaps:52/336 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SEATTTTTPVPRRKHSTRE----------QLHQMLAGGLSAAITRSTCQPLDVLKIRFQLQVEPL 63
            |...:..:|..||...|..          .|..::|||::..|......|.:.:|.:.||.    
  Fly     4 SAFASLVSPYRRRPWMTEHGAAAADSGQVGLKGIVAGGITGGIEICITYPTEYVKTQLQLD---- 64

  Fly    64 GKNAAKEGPGALTSKYTSIGQAVKTIYREEGMLAFWKGHNPAQVLSIMYGICQFWTYEQLSLMAK 128
            .|.|||        ||..|...||....|.|.|..::|.:.....||.....:|..:|.|     
  Fly    65 EKGAAK--------KYNGIFDCVKKTVGERGFLGLYRGLSVLVYGSIPKSAARFGAFEFL----- 116

  Fly   129 QTSYLADHQHLSN---FLCGAAAGGA-AVIISTPLDVIRTRLIAQDTSKG---YRNATRAVSAIV 186
            :::.:.....|||   .|||..||.. |::..||::.|:.:.| .|...|   :|.....|..|:
  Fly   117 KSNAVDSRGQLSNSGKLLCGLGAGVCEAIVAVTPMETIKVKFI-NDQRSGNPKFRGFAHGVGQII 180

  Fly   187 RQEGPRGMYRGLSSALLQITPLMGTNFMAYRLFSDWACAFLEVSDRSQLPTWTL-LGL-GASSGM 249
            :.||..|:|:||:..:|:    .|:| .|.|.|...:...|...|....|...| :|: ||.:|.
  Fly   181 KSEGISGIYKGLTPTILK----QGSN-QAIRFFVLESLKDLYKGDDHTKPVPKLVVGVFGAIAGA 240

  Fly   250 LSKTIVYPFDLIKKRLQIQGFESNRQTFGQTLQCHGVWDCLRLTVRQEGVRGLYKGVAPTLLKSS 314
            .|.....|.|::|.|:  ||.|:::  :..|..|     .:.: ::.||....|||..|.|.:..
  Fly   241 ASVFGNTPLDVVKTRM--QGLEASK--YKNTAHC-----AVEI-LKNEGPAAFYKGTVPRLGRVC 295

  Fly   315 MTTALYFSIYD 325
            :..|:.|.|||
  Fly   296 LDVAITFMIYD 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 26/93 (28%)
PTZ00169 33..329 CDD:240302 86/302 (28%)
Mito_carr 153..222 CDD:278578 21/71 (30%)
Mito_carr 233..328 CDD:278578 28/95 (29%)
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 83/300 (28%)
Mito_carr 34..117 CDD:278578 27/99 (27%)
Mito_carr 125..220 CDD:278578 31/100 (31%)
Mito_carr 235..314 CDD:278578 25/82 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441600
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.