DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and Mpcp1

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster


Alignment Length:364 Identity:79/364 - (21%)
Similarity:127/364 - (34%) Gaps:88/364 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TSEATTTTTPVPRRKHSTREQL----------------------HQMLAGGLSAAI----TRSTC 46
            ||..|:|....|..|.....||                      |..|..||...|    |.:..
  Fly    29 TSAPTSTAVVTPTLKDVAPRQLTRNHNIAAAAVAEGDSCEFGSNHYFLLCGLGGIISCGSTHTMV 93

  Fly    47 QPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKTIYREEGMLAFWKGHNPAQVLSIM 111
            .|||::|.|  |||:|              :||.|:....:....|||:....||..|..:...|
  Fly    94 VPLDLVKCR--LQVDP--------------AKYKSVFTGFRISLAEEGVRGLAKGWAPTFIGYSM 142

  Fly   112 YGICQFWTY------------EQLSLMAKQTSYLADHQHLSNFLCGAAAGGAAVIISTPLDVIRT 164
            .|:|:|..|            |:.:.:.:...|||         ..|:|...|.|...|::..:.
  Fly   143 QGLCKFGLYEVFKKVYGDAIGEENAFLYRTGLYLA---------ASASAEFFADIALAPMEAAKV 198

  Fly   165 RLIAQDTSKGYRNATR-AVSAIVRQEGPRGMYRGLSSALLQITPLMGTNFMAYRLFSDWACAFLE 228
            ::   .|:.|:....| |:..:..|||....|:||....::..|.....|..:....:....::.
  Fly   199 KI---QTTPGFAKTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTLELLYKYVV 260

  Fly   229 VSDRSQLPTWTLL----GLGASSGMLSKTIVYPFDLIKKRLQIQGFESNRQTFGQTLQCHGVWDC 289
            ...|:.......|    ..|..:|:....:.:|.|.:..:|       |:......|.       
  Fly   261 PKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKL-------NQAKGASALD------- 311

  Fly   290 LRLTVRQEGVRGLYKGVAPTLLKSSMTTALYFSIYDKLK 328
               ..:|.|..||:.|:.|.::.....||..:.|||.:|
  Fly   312 ---VAKQLGWSGLWGGLVPRIVMIGTLTAAQWFIYDAVK 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 31/131 (24%)
PTZ00169 33..329 CDD:240302 70/317 (22%)
Mito_carr 153..222 CDD:278578 14/69 (20%)
Mito_carr 233..328 CDD:278578 19/98 (19%)
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 29/104 (28%)
Mito_carr <188..258 CDD:278578 14/72 (19%)
Mito_carr 273..350 CDD:278578 20/92 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441568
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.