DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and hpo-12

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001379467.1 Gene:hpo-12 / 36804989 WormBaseID:WBGene00016588 Length:313 Species:Caenorhabditis elegans


Alignment Length:305 Identity:117/305 - (38%)
Similarity:162/305 - (53%) Gaps:39/305 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 AGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKTIYREEGMLAF 98
            ||..|..:||...|||||||||||||.||:        .|..:.||..:.|::..|.||||..||
 Worm    21 AGLASGIVTRMIIQPLDVLKIRFQLQEEPI--------RGKKSGKYKGVMQSIFLITREEGAHAF 77

  Fly    99 WKGHNPAQVLSIMYGICQFWTYEQLSLMAKQTSYLADHQHL---SNFLCGAAAGGAAVIISTPLD 160
            ||||.|||.||..||:.||.::|.||..|.:. ..||:|.:   |:|.|||.:|..|:..:.|||
 Worm    78 WKGHIPAQGLSATYGLVQFSSFEWLSQQAAKV-IPADNQSVRSTSDFACGALSGCLAMTAAMPLD 141

  Fly   161 VIRTRLIAQDTSKG-YRNATRAVSAIVRQEGPRGMYRGLSSALLQITPLMGTNFMAYRLFSDWAC 224
            ||||||:||..... |.....||..|..:||..|.:||...:::||.|..|..|..|..|.|   
 Worm   142 VIRTRLVAQKAGHAVYTGTMHAVKHIWEKEGIAGYFRGWVPSVVQIAPFTGMQFALYNCFMD--- 203

  Fly   225 AFLEVSDRSQLPTWTLLGL--------GASSGMLSKTIVYPFDLIKKRLQIQGFESNRQTFGQTL 281
                        .|...|.        ||.:|.::||::||.|:::.|||:.|||  |..||:|.
 Worm   204 ------------LWPFNGYESAGALFSGAMAGTVAKTVLYPLDMVRHRLQMNGFE--RAGFGKTS 254

  Fly   282 Q-CHGVWDCLRLTVRQEGVRGLYKGVAPTLLKSSMTTALYFSIYD 325
            . ..|::..:.:.|:.|...||:||:.|:.:|::..:...|..|:
 Worm   255 NYSQGLFKTIGMVVKNESWYGLFKGLWPSQIKAAANSGCAFLFYE 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 45/88 (51%)
PTZ00169 33..329 CDD:240302 117/305 (38%)
Mito_carr 153..222 CDD:278578 27/69 (39%)
Mito_carr 233..328 CDD:278578 31/102 (30%)
hpo-12NP_001379467.1 Mito_carr 11..102 CDD:395101 45/88 (51%)
Mito_carr 115..209 CDD:395101 37/108 (34%)
Mito_carr 216..309 CDD:395101 29/86 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157399
Domainoid 1 1.000 84 1.000 Domainoid score I5266
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 182 1.000 Inparanoid score I2639
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55227
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001923
OrthoInspector 1 1.000 - - otm14068
orthoMCL 1 0.900 - - OOG6_103578
Panther 1 1.100 - - LDO PTHR24089
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2969
SonicParanoid 1 1.000 - - X2188
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.930

Return to query results.
Submit another query.