DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and CG8323

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster


Alignment Length:304 Identity:81/304 - (26%)
Similarity:127/304 - (41%) Gaps:22/304 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKTIYREEGMLAFW 99
            |||::........|::|:|.|.|||    |:.||:   |.....|..|..|..|:.:.:|:....
  Fly     9 GGLASVGATFFTNPIEVIKTRIQLQ----GELAAR---GTYVEPYKGIVNAFITVAKNDGITGLQ 66

  Fly   100 KGHNPAQVLSIMYGICQFWTYEQLSLMAKQTSYLADHQHLSNFLCGAAAGGAAVIISTPLDVIRT 164
            ||..||.....:....:...|.:........:...:..:....|.||..|......|:|..:|:|
  Fly    67 KGLAPALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMGLLWGAIGGVVGCYFSSPFFLIKT 131

  Fly   165 RL---IAQDTSKGYRNA----TRAVSAIVRQEGPRGMYRGLSSALLQITPLMGTNFMAYRLFSDW 222
            :|   .|:..:.||::|    |.|:..|..:.|.||::||..:||.:.....|.....:....  
  Fly   132 QLQSQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKTK-- 194

  Fly   223 ACAFLEVSDRSQLPTWTLLGLGASSGMLSKTIVYPFDLIKKRLQIQGFESNRQTFGQTLQCHGVW 287
              |.|...|....||......|..:|.:....:.|.|:|..||..||.::.    |:.|...|..
  Fly   195 --ALLVQYDLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAE----GRGLLYRGWL 253

  Fly   288 DCLRLTVRQEGVRGLYKGVAPTLLKSSMTTALYFSIYDKLKQVR 331
            ||....:|.|||.|:|||.....|:.:..:.|....:|:|..||
  Fly   254 DCFVKILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFDELVAVR 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 24/87 (28%)
PTZ00169 33..329 CDD:240302 79/300 (26%)
Mito_carr 153..222 CDD:278578 20/75 (27%)
Mito_carr 233..328 CDD:278578 27/94 (29%)
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 23/84 (27%)
PTZ00169 5..293 CDD:240302 78/298 (26%)
Mito_carr 101..200 CDD:278578 26/102 (25%)
Mito_carr 206..301 CDD:278578 30/96 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441271
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.