DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and CG9582

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster


Alignment Length:345 Identity:91/345 - (26%)
Similarity:144/345 - (41%) Gaps:88/345 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RRKHSTREQLH-QMLAGGLSAAITRSTCQPLDVLKIRFQLQ-VEPLGKNAAKEGPGALTSKYTSI 82
            |.:.:.|...| |.||||||..|......||||:|.|.|:| ..|.|....          ||..
  Fly     4 RSEETVRSLAHWQFLAGGLSGFIEIICFHPLDVVKTRMQIQGAHPFGGEVV----------YTCP 58

  Fly    83 GQAVKTIYREEGMLAFWKGHNPAQVLSIMYGIC--------QFWTYEQL----SLMAKQTSYLAD 135
            ..|:..|||.||:.:.|||        |:..||        :|..||.|    ...|.|.:.|..
  Fly    59 LDAIVKIYRYEGLSSLWKG--------IVPPICVETPKRGGKFLMYESLKPYFQFGAPQPTPLTH 115

  Fly   136 HQHLSNFLCGAAAGGAAVIIST----PLDVIRTRLIAQDTSKGYRNAT-RAVSAIVRQE--GPRG 193
                      |.:|..|.|:.:    |.:|::   |.|...:|.|..| ..|..|::.:  |.:|
  Fly   116 ----------AMSGSMAAILESFLVNPFEVVK---ITQQAHRGKRLKTLSVVKYIIKHDGYGIKG 167

  Fly   194 MYRGLSSALLQITPLMGTNFMAYRLFSDWACAFLEVSDRSQLPTWTLL------GLGAS-SGMLS 251
            :|||       ||.|:..|.:.:..|..:..|..::....:..|:.:|      ||.:| :.::|
  Fly   168 LYRG-------ITALVARNAVFHFGFFGFYNALKDIVPSPEDKTYNILRKVIIAGLASSLACVMS 225

  Fly   252 KTIVYPFDLIKKRLQ----IQGFESNRQTFGQTLQCHGVWDCLRLTVRQEGVRGLYKGVAPTLLK 312
            .|:    |:.|.|:|    ::|....:.|.          ..::.|.::||.|.|:||:...:|:
  Fly   226 VTL----DMAKCRIQGPQPVKGEVKYQWTI----------STIKSTFKEEGFRSLFKGLGAMILR 276

  Fly   313 ----SSMTTALYFSIYDKLK 328
                .:|....|..:::.||
  Fly   277 VGPGGAMLLVTYEYLFEFLK 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 36/103 (35%)
PTZ00169 33..329 CDD:240302 87/331 (26%)
Mito_carr 153..222 CDD:278578 20/75 (27%)
Mito_carr 233..328 CDD:278578 23/109 (21%)
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 85/330 (26%)
Mito_carr 17..104 CDD:278578 35/104 (34%)
Mito_carr 109..196 CDD:278578 26/106 (25%)
Mito_carr 216..295 CDD:278578 20/92 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441613
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.