DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and MME1

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster


Alignment Length:296 Identity:75/296 - (25%)
Similarity:130/296 - (43%) Gaps:34/296 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKTIYREEGMLA 97
            :|||:..........|||.:|:|.|....|         |.....:|..:.......:|.||...
  Fly    19 IAGGVGGMCNVLVGHPLDTIKVRLQTMPTP---------PPGQPPRYKGVIDCAARTFRYEGFRG 74

  Fly    98 FWKGHN-PAQVLSIMYGICQFWTYEQLSLMAKQTSYLADHQHLSN---FLCGAAAGGAAVIISTP 158
            |::|.: |...::.:|.: .|..|    ...|:.....||..|:.   |..||.||..:.:::.|
  Fly    75 FYRGISAPLVGVTPIYAV-DFAVY----AAGKRLFQTDDHIRLTYPQIFAAGALAGVCSALVTVP 134

  Fly   159 LDVIRTRLIAQDTSKG---YRNATRAVSAIVRQEGPRGMYRGLSSALLQITPLMGTNFMAYRLFS 220
            .|.|:..|..|..|.|   |.......:.:.||.|.|.:::|..:.:|:.:| .|..|:.|....
  Fly   135 TDRIKVLLQTQTVSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSP-TGFYFVTYEFLQ 198

  Fly   221 DWACAFLEVSDRSQLPTWTLLGLGASSGMLSKTIVYPFDLIKKRLQIQGFESNRQTFGQTLQCHG 285
            :.|   .:.|...::.|.:.:..|.::|::..|:..|||::|.|||    .:...|:.     ||
  Fly   199 ELA---RKKSANGKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQ----SAPEGTYK-----HG 251

  Fly   286 VWDCLRLTVRQEGVRGLYKGVAPTLLKSSMTTALYF 321
            :....|..:..||.:.|::|:.|.||::..:||..|
  Fly   252 IRSVFRNLMATEGPKALFRGILPILLRAFPSTAAVF 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 21/90 (23%)
PTZ00169 33..329 CDD:240302 75/296 (25%)
Mito_carr 153..222 CDD:278578 18/71 (25%)
Mito_carr 233..328 CDD:278578 25/89 (28%)
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 22/101 (22%)
Mito_carr 111..205 CDD:278578 25/97 (26%)
Mito_carr 208..297 CDD:278578 25/89 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441563
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.