DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and Ucp4B

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster


Alignment Length:315 Identity:69/315 - (21%)
Similarity:137/315 - (43%) Gaps:55/315 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 STCQ------PLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKTIYREEGMLAFWKGH 102
            |.|.      |.|:.|.|.|:|    |:.|::.|..|   ||..:......|.||||:|..:.|.
  Fly    46 SACSAEIVGYPFDMCKTRMQIQ----GEIASRVGQKA---KYRGLLATAMGIVREEGLLKLYGGI 103

  Fly   103 NPAQVLSIMYGICQFWTYEQLSLMAKQTSYLADH------QHLSNFLCGAAAGGAAVIISTPLDV 161
            :.......::...:..||:.:    ::...:.|.      ..|.:.:.|..||..|.:::.|.::
  Fly   104 SAMLFRHSLFSGIKMLTYDYM----REKMIVPDEDGRPQLSFLGSCISGVLAGATASVLTNPTEL 164

  Fly   162 IRTRLIAQDTSKGYR----------NATRAVSAIVRQEGPRGMYRGL-----SSALLQITPLMGT 211
            |:.::    ..:|.|          |..:|:::|.|..|..|:::|.     .|||:.|..:...
  Fly   165 IKIQM----QMEGQRRLRGEPPRIHNVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIGDVSCY 225

  Fly   212 NFMAYRLFSDWACAFLEVSDRSQLPTWTLLGLGASSGMLSKTIVYPFDLIKKRLQIQGFESNRQT 276
            :|....|.:::     ::.|..::.....:..|.:..:||    .|.|::|.|:..|..:..   
  Fly   226 DFCKRFLIAEF-----DLVDNREVQFVAAMTAGVADAILS----LPADVVKSRIMNQPTDEQ--- 278

  Fly   277 FGQTLQCHGVWDCLRLTVRQEGVRGLYKGVAPTLLKSSMTTALYFSIYDKLKQVR 331
             |:.:...|..|||...||:||...:|||..|..::....:.:::..::::::.|
  Fly   279 -GRGIHYKGSLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRRFR 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 23/84 (27%)
PTZ00169 33..329 CDD:240302 68/311 (22%)
Mito_carr 153..222 CDD:278578 17/83 (20%)
Mito_carr 233..328 CDD:278578 21/94 (22%)
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 65/287 (23%)
Mito_carr 32..129 CDD:278578 23/93 (25%)
Mito_carr 138..233 CDD:278578 21/98 (21%)
Mito_carr 246..331 CDD:278578 21/92 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441556
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.