DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and colt

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster


Alignment Length:317 Identity:77/317 - (24%)
Similarity:130/317 - (41%) Gaps:31/317 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TTTTTPVPRRKHSTREQLHQMLAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALT 76
            |||......||   ...:...|.||........:..|||.:|:|.|....|        .||...
  Fly     2 TTTENVSTERK---ANPVKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRP--------APGEQP 55

  Fly    77 SKYTSIGQAVKTIYREEGMLAFWKGHN-PAQVLSIMYGICQFWTYEQLSLMAKQTSYLADHQHLS 140
            ....:...|.||| :.||:...:||.: |...::.::.:| |..| .|....:|....|...:..
  Fly    56 LYRGTFDCAAKTI-KNEGVRGLYKGMSAPLTGVAPIFAMC-FAGY-ALGKRLQQRGEDAKLTYPQ 117

  Fly   141 NFLCGAAAGGAAVIISTPLDVIRTRLIAQDTSKG---YRNATRAVSAIVRQEGPRGMYRGLSSAL 202
            .|:.|:.:|..:.:|..|.:.|:..|..|....|   |.........:.::.|.|.:::|..:.:
  Fly   118 IFVAGSFSGLFSTLIMAPGERIKVLLQTQQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATM 182

  Fly   203 LQITPLMGTNFMAYRLFSDWACAFLEVSDRSQLPTWTLLGLGASSGMLSKTIVYPFDLIKKRLQI 267
            |:..|..|..|:.|....|.|   ...|:..|:.|.:.:..|..:||....:..|.|::|.||| 
  Fly   183 LRDLPANGLYFLVYEALQDVA---KSKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQ- 243

  Fly   268 QGFESNRQTFGQTLQCHGVWDCLRLTVRQEGVRGLYKGVAPTLLKS-SMTTALYFSI 323
               .:...|:.     ||:....:..:.::|...||:||.|.:|:: ....|.:|.|
  Fly   244 ---SAPEGTYK-----HGIRSVFKDLIVKDGPLALYRGVTPIMLRAFPANAACFFGI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 24/94 (26%)
PTZ00169 33..329 CDD:240302 72/296 (24%)
Mito_carr 153..222 CDD:278578 15/71 (21%)
Mito_carr 233..328 CDD:278578 24/92 (26%)
coltNP_477221.1 Mito_carr 12..107 CDD:395101 26/108 (24%)
Mito_carr 112..202 CDD:395101 18/89 (20%)
Mito_carr 210..299 CDD:395101 24/92 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441562
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.