DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and Rim2

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster


Alignment Length:364 Identity:85/364 - (23%)
Similarity:139/364 - (38%) Gaps:74/364 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 STREQLHQMLAGGLSAAITRSTCQPLDVLKIRFQLQ---------VEPLGKNAAKEGPGAL---- 75
            :|.:.|..::|||.:..:......||:|:|.|.|..         .|..|...|..|...|    
  Fly     4 NTADTLIHLIAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPE 68

  Fly    76 ------------------------------------TSKYTSIGQAVKTIYREEGMLAFWKGHNP 104
                                                |.|..||.|.::.|.:.||..|.:||..|
  Fly    69 QRRKLSTTILRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGP 133

  Fly   105 AQVLSIMYGICQFWTYEQLSLMAKQTSYLADHQHLSNFLCGAAAGGAAVIISTPLDVIRTRLIAQ 169
            ..|.........|.||.|.........::.....|.:.:..|:||..:...:.|:..::||:...
  Fly   134 NLVGVAPSRAIYFCTYSQTKNTLNSLGFVERDSPLVHIMSAASAGFVSSTATNPIWFVKTRMQLD 198

  Fly   170 DTSKGYRNATRAVSAIVRQEGPRGMYRGLSSALLQITPLMGTNFMAYRLFSDWACAFLEVSDRSQ 234
            ..||......:.:..:..|.|....|:|::::...|...| .:|:.|.....   ..||  .|:|
  Fly   199 YNSKVQMTVRQCIERVYAQGGVAAFYKGITASYFGICETM-VHFVIYEFIKS---KLLE--QRNQ 257

  Fly   235 LPTWT--------LLGLGASSGMLSKTIVYPFDLIKKRLQIQGFESNRQTFGQTLQCHGVWDCLR 291
            ..|.|        .:..||.|..::..|.||.::.:.||:.:|.:.|  :|.|||  |.||    
  Fly   258 RHTDTKGSRDFLEFMMAGAVSKTIASCIAYPHEVARTRLREEGNKYN--SFWQTL--HTVW---- 314

  Fly   292 LTVRQEGVRGLYKGVAPTLLKSSMTTALYFSIYDKLKQV 330
               ::||..|||:|:|..|::....||:..:.|:.:..|
  Fly   315 ---KEEGRAGLYRGLATQLVRQIPNTAIMMATYEAVVYV 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 31/142 (22%)
PTZ00169 33..329 CDD:240302 82/352 (23%)
Mito_carr 153..222 CDD:278578 13/68 (19%)
Mito_carr 233..328 CDD:278578 31/102 (30%)
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 32/147 (22%)
Mito_carr 163..253 CDD:278578 17/93 (18%)
Mito_carr 268..355 CDD:278578 29/94 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441620
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.