DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and Slc25a48

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_808477.2 Gene:Slc25a48 / 328258 MGIID:2145373 Length:306 Species:Mus musculus


Alignment Length:344 Identity:78/344 - (22%)
Similarity:134/344 - (38%) Gaps:90/344 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QLHQMLAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKTIYRE 92
            ||...:||.:....:.....|||.:|.|.|            .|.|     |.:....::.:|:.
Mouse     5 QLEDFVAGWIGGVASVIVGYPLDTVKTRLQ------------AGVG-----YANTFNCIRMVYKR 52

  Fly    93 EGMLAFWKGHN-PAQVL----SIMYGICQFWTYEQLSLMAKQTSYLADHQHLSNFLCGAAAGG-- 150
            |.:..|:||.: |...:    |:::|:                 :....:.||.:.||....|  
Mouse    53 ERVFGFFKGMSFPLASIAIYNSVVFGV-----------------FSNTQRFLSKYRCGELEAGPG 100

  Fly   151 ---------------AAVIISTPLDVIRTRLIAQ-----DTSKG--------YRNATRAVSAIVR 187
                           .:|.:..|:::|:.||..|     :.|.|        |:.....::.||:
Mouse   101 RSLSDLLLASMLTGVVSVGLGGPVELIKIRLQMQTQPFREASHGLKSRAVAAYQGPVHCIATIVQ 165

  Fly   188 QEGPRGMYRGLSSALLQITPLMGTNFMAYRLFSDW----ACAFLEVSDRSQLPTWTLLGLGASSG 248
            .||..|:|||.|:.||:..|.....|:.|...|:|    ||     :..|....|.   .|..:|
Mouse   166 MEGLTGLYRGASAMLLRDIPGYCFYFIPYVFLSEWITPEAC-----TGPSPYAAWL---AGGIAG 222

  Fly   249 MLSKTIVYPFDLIKKRLQIQGFESNRQTFGQTLQCHGVWDCLRLTVRQEGVRGLYKGVAPTLLKS 313
            .:|.....|.|::|.|:|..|...|:.        .||.||:..:.:|||.:..::|:....::.
Mouse   223 AISWGTATPMDVVKSRIQADGVYLNKY--------RGVVDCISQSYQQEGFKVFFRGITVNAVRG 279

  Fly   314 -SMTTALYFSIYDKLKQVR 331
             .|:.|::......||.:|
Mouse   280 FPMSAAMFLGYELSLKALR 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 20/98 (20%)
PTZ00169 33..329 CDD:240302 74/335 (22%)
Mito_carr 153..222 CDD:278578 24/81 (30%)
Mito_carr 233..328 CDD:278578 22/95 (23%)
Slc25a48NP_808477.2 Solcar 1 3..86 21/114 (18%)
Mito_carr 6..89 CDD:365909 21/116 (18%)
Solcar 2 101..200 24/98 (24%)
Mito_carr 107..202 CDD:365909 25/94 (27%)
Mito_carr 209..299 CDD:365909 25/101 (25%)
Solcar 3 209..296 23/97 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0752
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.