DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and Ucp4A

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster


Alignment Length:363 Identity:91/363 - (25%)
Similarity:162/363 - (44%) Gaps:62/363 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVTTGSTSEA---TTTTTPVPRRKHSTREQLHQM------------LAGGLSAAITRSTCQPLD 50
            ||..|..:|.|   :|::.|.|   .|.|.||..:            :...::|:|......|||
  Fly     1 MAAKTDESSPAVASSTSSNPAP---SSGRHQLRPVKFDYADSFACTYIVSVVAASIAELATYPLD 62

  Fly    51 VLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKTIYREEGMLAFWKGHNPAQVLSIMYGIC 115
            :.|.|.|:|.|....:|.|.     ..:|..:......|.||||.|..|:|..||....::|...
  Fly    63 LTKTRLQIQGEGAAHSAGKS-----NMQYRGMVATAFGIAREEGALKLWQGVTPALYRHVVYSGV 122

  Fly   116 QFWTYEQLSLMAKQTSYLADHQHL---SNFLCGAAAGGAAVIISTPLDVI--------RTRLIAQ 169
            :..:|:   ||.|:.:.... |.|   .:.|||..||..|..:::|.|::        |.||:.:
  Fly   123 RICSYD---LMRKEFTQNGT-QALPVWKSALCGVTAGAVAQWLASPADLVKVQIQMEGRRRLMGE 183

  Fly   170 DTSKGYRNATRAVSAIVRQEGPRGMYRG-----LSSALLQITPLMGTNFMAYRLFSDWACAFLEV 229
            ...  ..:|..|...||::.|.:|:::|     ..:||:.:..|...:.:.:.           :
  Fly   184 PPR--VHSAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYDTIKHL-----------I 235

  Fly   230 SDRSQLPTWTLLGLGAS--SGMLSKTIVYPFDLIKKRLQIQGFESNRQTFGQTLQCHGVWDCLRL 292
            .:|.|:|....:.:.||  :|.::..:..|.|::|.|:..|..:.|    |:.|...|..||||.
  Fly   236 MNRLQMPDCHTVHVLASVCAGFVAAIMGTPADVVKTRIMNQPTDEN----GRGLLYRGSVDCLRQ 296

  Fly   293 TVRQEGVRGLYKGVAPTLLKSSMTTALYFSIYDKLKQV 330
            ||.:||...||||..|..::.:..:..::..:::::::
  Fly   297 TVSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRKM 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 26/105 (25%)
PTZ00169 33..329 CDD:240302 79/313 (25%)
Mito_carr 153..222 CDD:278578 15/81 (19%)
Mito_carr 233..328 CDD:278578 27/96 (28%)
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 79/322 (25%)
Mito_carr 39..138 CDD:278578 28/106 (26%)
Mito_carr 142..239 CDD:278578 22/109 (20%)
Mito_carr 248..336 CDD:278578 25/91 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441558
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.