DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and sesB

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster


Alignment Length:326 Identity:83/326 - (25%)
Similarity:142/326 - (43%) Gaps:72/326 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 AGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKTIYREEGMLAF 98
            |||:|||::::...|::  :::..|||:.:.|..:.:      .:|..:......|.:|:|..:|
  Fly    29 AGGISAAVSKTAVAPIE--RVKLLLQVQHISKQISPD------KQYKGMVDCFIRIPKEQGFSSF 85

  Fly    99 WKG-------HNPAQVLSIMY----------GI---CQFWTYEQLSLMAKQTSYLADHQHLSNFL 143
            |:|       :.|.|.|:..:          |:   .|||.|                 ...|..
  Fly    86 WRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRY-----------------FAGNLA 133

  Fly   144 CGAAAGGAAVIISTPLDVIRTRLIAQDTSKG----YRNATRAVSAIVRQEGPRGMYRGLSSALLQ 204
            .|.|||..::....|||..|||| |.||.||    :......::.|.:.:|..|:|||...::..
  Fly   134 SGGAAGATSLCFVYPLDFARTRL-AADTGKGGQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQG 197

  Fly   205 ITPLMGTNFMAYRLFSDWACAFLEVSDRSQLP---TWTLLGLGAS-SGMLSKTIVYPFDLIKKRL 265
            |.....    ||..|.|.|...|  .|....|   :|.:..:..: :|::|    ||||.:::|:
  Fly   198 IIIYRA----AYFGFYDTARGML--PDPKNTPIYISWAIAQVVTTVAGIVS----YPFDTVRRRM 252

  Fly   266 QIQ-GFESNRQTFGQTLQCHGVWDCLRLTVRQEGVRGLYKGVAPTLLKSSMTTALYFSIYDKLKQ 329
            .:| |.::....:..||.|   |..:   .:|||....:||....:|:.: ..|....:||::|:
  Fly   253 MMQSGRKATEVIYKNTLHC---WATI---AKQEGTGAFFKGAFSNILRGT-GGAFVLVLYDEIKK 310

  Fly   330 V 330
            |
  Fly   311 V 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 26/108 (24%)
PTZ00169 33..329 CDD:240302 81/323 (25%)
Mito_carr 153..222 CDD:278578 22/72 (31%)
Mito_carr 233..328 CDD:278578 24/99 (24%)
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 21/94 (22%)
PTZ00169 23..312 CDD:240302 83/326 (25%)
Mito_carr 124..220 CDD:278578 34/119 (29%)
Mito_carr 223..312 CDD:278578 26/100 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441608
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.