DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and RGD1561206

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_038956923.1 Gene:RGD1561206 / 308678 RGDID:1561206 Length:321 Species:Rattus norvegicus


Alignment Length:304 Identity:120/304 - (39%)
Similarity:169/304 - (55%) Gaps:19/304 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 TREQLHQMLAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKTI 89
            :..:|...:||.:|..:||:...||||:|||||||:|       :..|....:||..|.||.|.|
  Rat    20 SNSKLEVAVAGSVSGFVTRALISPLDVIKIRFQLQLE-------RVCPSDPDAKYHGIFQAAKQI 77

  Fly    90 YREEGMLAFWKGHNPAQVLSIMYGICQFWTYEQLSLMAKQTSYLADHQHLSNFLCGAAAGGAAVI 154
            .:|||..||||||.|||:|||.||..||..:|:|:::..|.:....||..::|:||..:.|.|.:
  Rat    78 IQEEGPRAFWKGHVPAQILSIGYGAVQFLAFEELTVLLYQANLYQTHQFSAHFVCGGLSAGTATL 142

  Fly   155 ISTPLDVIRTRLIAQDTSKGYRNATRAVSAIVRQEGPRGMYRGLSSALLQITPLMGTNFMAYRLF 219
            ...|:||:||||.||    |..|...|:..:.|.|||...|:||:..::.|.|..|..| .||..
  Rat   143 TVHPVDVLRTRLAAQ----GEPNLREAIITMYRTEGPFVFYKGLTPTVIAIFPYAGLQF-CYRSL 202

  Fly   220 S---DWACAFLEVSDRSQLPTWTLLGLGASSGMLSKTIVYPFDLIKKRLQIQGFESNRQTFGQTL 281
            .   ||...    .||.|......|..|..||::|||:.||.||.|..||::|||..|..|||..
  Rat   203 KRTYDWVMP----PDRKQTGNLKNLLCGCGSGVISKTLTYPLDLFKNHLQVRGFEYARSAFGQVR 263

  Fly   282 QCHGVWDCLRLTVRQEGVRGLYKGVAPTLLKSSMTTALYFSIYD 325
            ...|:.|..|..::.|..||.:||::|:|:|::::|...|..|:
  Rat   264 SYRGLLDLARQVLQHEDTRGFFKGLSPSLMKAALSTGFMFFWYE 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 46/93 (49%)
PTZ00169 33..329 CDD:240302 119/296 (40%)
Mito_carr 153..222 CDD:278578 25/71 (35%)
Mito_carr 233..328 CDD:278578 36/93 (39%)
RGD1561206XP_038956923.1 Mito_carr 24..111 CDD:395101 46/93 (49%)
Mito_carr 126..206 CDD:395101 30/84 (36%)
Mito_carr 215..314 CDD:395101 36/93 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336587
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24089
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.